TkAUNG093800 | RubberDandelionOmics

Gene overview

TkAUNG093800

Reference: TK1151 Chr: ChrUn Coordinates: 26542546-26544883 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2178 bp · TkAUNG093800|TK1151|cDNA

AAAAAAGTAGGGAAGTGGGAAGAGGTTATGATGGACCTTGTGATGAAATTGCCAAAGATGTCTAAACAACACAAGAGCATCTCAATTATGATATAGATCGATTGACGAAATATACTCAGCTTCTTTTTGTTCGTGAGTTTTATTTGATGGACCGATGGATACAATTGTATATTGACGAAATTATTGTACTGACATTGGTGTACCATCGTGATTCTAAATTCTCTTCCAAGTTTTGGACTACTTACCGTTGAGCATTTATT...

CDS

Download CDS FASTA

1074 bp · TkAUNG093800|TK1151|CDS

ATGGCCCCTCGCCGTCGCCGGCTCCCTTCCTTCTGCAAGATCTTGCTCGACCTTCCCGCCCCTCACCTGCCATTGCCACCCGATTTTGTAAGGAAGCACTTAGAGAACAATATTCCCGAGGATCCAACACTCCTATCCGTAAATGGAGGGTATTCGTGGAGATTGAAGATCAGAAAAGATGGTGATAATTACTGCTTTGCCGATGGATGGAGAGACGTGGTTGAAGATAGCCTGTTGGAATATGGGGATTTTCTCGTCTT...

Protein

Download Protein FASTA

357 aa · TkAUNG093800|TK1151|PROTEIN

MAPRRRRLPSFCKILLDLPAPHLPLPPDFVRKHLENNIPEDPTLLSVNGGYSWRLKIRKDGDNYCFADGWRDVVEDSLLEYGDFLVFWLVDKSTFKLSVFSPSGCEKMFPLNEDEEDDHVEEEDEVAQMNEQVKQEEELDDEDEEEEDDDEEEQEQEQESEDEDEDFDEEEEEEEEEEDDDVYEGGGGGGGEEEDEGDEEDDDGDGDIDGNDGDPFFMRIISEDHTRSLRLRLPLGFARLAGLDRERRIKMKNLDGEEWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG093800`
TK1151 ID	TkAUNG093800
OH-1004 ID	LXL04_011498
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 96.078 / OH-1004 66.348 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG093800

Location ChrUn:26542546-26544883 (-)

Description Similar to At5g66980: Putative B3 domain-containing protein At5g66980

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0197600`	B3 domain-containing protein Os11g0197600.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011498 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G18960

ath:AT4G01580

ath:AT5G66980

dosa:Os01g0905400

dosa:Os11g0197600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · TkAUNG093800 · TK1151

Cytoplasm0.087

Rank 2 · TkAUNG093800 · TK1151

Cell membrane0.028

Rank 3 · TkAUNG093800 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkAUNG093800 · TK1151

Extracellular0.009

Rank 5 · TkAUNG093800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B323-100 aa

PF03754At2g31720-like53-89 aa

PF02535Zip100-175 aa

PF24871Piezo_TM1-24111-177 aa

PF02724CDC45113-192 aa

PF04147Nop14113-199 aa

PF29507SEG2114-288 aa

PF01080Presenilin118-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG093800	`PF02362`	B3	23	100	1.1e-29	103.0
TkAUNG093800	`PF03754`	At2g31720-like	53	89	3e-08	34.3
TkAUNG093800	`PF02535`	Zip	100	175	1.2	9.0
TkAUNG093800	`PF24871`	Piezo_TM1-24	111	177	2.1	7.4
TkAUNG093800	`PF02724`	CDC45	113	192	0.1	11.6
TkAUNG093800	`PF04147`	Nop14	113	199	3.3	6.5
TkAUNG093800	`PF29507`	SEG2	114	288	0.0059	16.6
TkAUNG093800	`PF01080`	Presenilin	118	175	0.15	11.5
TkAUNG093800	`PF02362`	B3	217	311	1.1e-29	103.0
TkAUNG093800	`PF03754`	At2g31720-like	274	316	3e-08	34.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2R9D2`	Oryza sativa subsp. japonica	sp\|Q2R9D2\|Y1176_ORYSJ B3 domain-containing protein Os11g0197600	31.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card