TkAUNG045190 | RubberDandelionOmics

Gene overview

TkAUNG045190

Reference: TK1151 Chr: ChrUn Coordinates: 12546306-12547662 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · TkAUNG045190|TK1151|cDNA

ATGTTCTACCAGTACTACCTGTCCCTTCAGCCGGGCCGAAGCCTCTGTGGGCATTTAATGTTTTCCAGGCCGAAGGTCTTCCTGGGACGCGCTTCGGCTCAGATTTCATCCCAGGGTCCGGCTTCGGACCCTCGGTATTTCTATAGTTGGAAGGTTCTTCAATCGGAAGCTGCTCGAAACGGCATCGTCTTGCTGAAGGTGTCGCTCGGAAATTGCTCGGAAATTACGAAGGTGTCGCTCACTGTTCTTCAAGCATTCCA...

CDS

Download CDS FASTA

489 bp · TkAUNG045190|TK1151|CDS

ATGTTCTACCAGTACTACCTGTCCCTTCAGCCGGGCCGAAGCCTCTGTGGGCATTTAATGTTTTCCAGGCCGAAGGTCTTCCTGGGACGCGCTTCGGCTCAGATTTCATCCCAGGGTCCGGCTTCGGACCCTCGGTATTTCTATAGTTGGAAGGTTCTTCAATCGGAAGCTGCTCGAAACGGCATCGTCTTGCTGAAGGTGTCGCTCGGAAATTGCTCGGAAATTACGAAGGTGTCGCTCACTGTTCTTCAAGCATTCCA...

Protein

Download Protein FASTA

162 aa · TkAUNG045190|TK1151|PROTEIN

MFYQYYLSLQPGRSLCGHLMFSRPKVFLGRASAQISSQGPASDPRYFYSWKVLQSEAARNGIVLLKVSLGNCSEITKVSLTVLQAFQNYVKTTHYHPGCVDSVNCTSVAIDEAVSIAKSVDYMIMVMGLDQTQEREKLDRLDLVLPRKQSALVSAVARSAGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG045190`
TK1151 ID	TkAUNG045190
OH-1004 ID	LXL04_035808
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.200
Protein coverage (%)	TK1151 66.667 / OH-1004 16.875 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG045190

Location ChrUn:12546306-12547662 (-)

Description Similar to BXL7: Probable beta-D-xylosidase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78060`	Probable beta-D-xylosidase 7.	No verified direct reference in this release
`At5g10560`	Probable beta-D-xylosidase 6.	No verified direct reference in this release
`At5g09730`	Involved in the hydrolysis of arabinan.	Purification, functional characterization, cloning, and identification of mutants of a seed-specific arabinan hydrolase in Arabidopsis.2006 · DOI: 10.1093/jxb/erj205

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035808 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009627 systemic acquired resistance Biological Process

GO:0031222 arabinan catabolic process Biological Process

GO:0045493 xylan catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G78060

ath:AT3G19620

ath:AT5G09730

ath:AT5G10560

ath:AT5G64570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.372

Rank 1 · TkAUNG045190 · TK1151

Cytoplasm0.249

Rank 2 · TkAUNG045190 · TK1151

Nucleus0.182

Rank 3 · TkAUNG045190 · TK1151

Plastid0.177

Rank 4 · TkAUNG045190 · TK1151

Peroxisome0.082

Rank 5 · TkAUNG045190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01915Glyco_hydro_3_C67-158 aa

PF03747ADP_ribosyl_GH82-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG045190	`PF01915`	Glyco_hydro_3_C	67	158	2.6e-10	41.3
TkAUNG045190	`PF03747`	ADP_ribosyl_GH	82	141	0.2	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGZ5`	Arabidopsis thaliana	sp\|Q9SGZ5\|BXL7_ARATH Probable beta-D-xylosidase 7	42.300%	Swiss-Prot	Medium
`Q9LXA8`	Arabidopsis thaliana	sp\|Q9LXA8\|BXL6_ARATH Probable beta-D-xylosidase 6	50.000%	Swiss-Prot	Low
`Q9LXD6`	Arabidopsis thaliana	sp\|Q9LXD6\|BXL3_ARATH Beta-D-xylosidase 3	35.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card