RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG022910
Reference: TK1151 Chr: ChrUn Coordinates: 6137140-6139818 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1963 bp · TkAUNG022910|TK1151|cDNA

GAATCACAACTTGTAAGTGGCATACACCAATCATCCATAAAGGAACTCTCATCATCCATAACACAAGAACACGCCGAATCAGATCTAATGCTCCATTTCCTCGCATCCCTAAAAGACCAAAAACAAAAACACGGCTCAAAACTAATCGAAGAAATCAAATGTGTAGAATCCGACATTTCAGAAATCAAATCAAGACAACCCAAACACCACCTCCCAAATCCAAAACCCACCCATCCCCCATCACGCCTTATAACCAACAT...

CDS

Download CDS FASTA

1359 bp · TkAUNG022910|TK1151|CDS

ATGCTCCATTTCCTCGCATCCCTAAAAGACCAAAAACAAAAACACGGCTCAAAACTAATCGAAGAAATCAAATGTGTAGAATCCGACATTTCAGAAATCAAATCAAGACAACCCAAACACCACCTCCCAAATCCAAAACCCACCCATCCCCCATCACGCCTTATAACCAACATGAACCATCTAGAACACGCCTACTTCTCCATCAGGTCCACCGTAACAACCCCGGACCACGACAACACAGAAGAACACGAAGTCTTAAC...

Protein

Download Protein FASTA

452 aa · TkAUNG022910|TK1151|PROTEIN

MLHFLASLKDQKQKHGSKLIEEIKCVESDISEIKSRQPKHHLPNPKPTHPPSRLITNMNHLEHAYFSIRSTVTTPDHDNTEEHEVLTSRENNNNNIVRKVANKCEDRLGMFFNGLCKYARYSKFEVKGVLRNGDFSSMGNVICSLGFDRDEDYFATAGVSKKIKVYDFEALLSDSVDIHYPAVEMANKSKISCICWNNYIRNYLASTDYDGVVKIWDAGTGEVVSQHMEHEKRAWSVDFSKVDPMKLASGSDDCSVKLWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG022910
TK1151 IDTkAUNG022910
OH-1004 IDLXL04_037649
Relationship / confidenceMulti Candidate From Tk1151 / Complex relationship
Protein identity (%)52.400
Protein coverage (%)TK1151 92.478 / OH-1004 48.565
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG022910
LocationChrUn:6137140-6139818 (+)
DescriptionSimilar to SPA3: Protein SPA1-RELATED 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g11110 Involved in suppression of photomorphogenesis in dark-grown seedlings.
The SPA quartet: a family of WD-repeat proteins with a central role in suppression of photomorphogenesis in arabidopsis.2004 · DOI: 10.1105/tpc.104.024216
Functional and expression analysis of Arabidopsis SPA genes during seedling photomorphogenesis and adult growth.2006 · DOI: 10.1111/j.1365-313x.2006.02812.x
UniProt: Q9SYX2 Controls normal photoperiodic flowering and regulates circadian rhythms. No verified direct reference in this release
At1g53090 Repressor of photomorphogenesis in the light.
The SPA1-like proteins SPA3 and SPA4 repress photomorphogenesis in the light.2003 · DOI: 10.1046/j.1365-313x.2003.01813.x
Functional and expression analysis of Arabidopsis SPA genes during seedling photomorphogenesis and adult growth.2006 · DOI: 10.1111/j.1365-313x.2006.02812.x
Arabidopsis SPA proteins regulate photoperiodic flowering and interact with the floral inducer CONSTANS to regulate its stability.2006 · DOI: 10.1242/dev.02481
At3g15354 Repressor of photomorphogenesis in the light.
The SPA1-like proteins SPA3 and SPA4 repress photomorphogenesis in the light.2003 · DOI: 10.1046/j.1365-313x.2003.01813.x
Functional and expression analysis of Arabidopsis SPA genes during seedling photomorphogenesis and adult growth.2006 · DOI: 10.1111/j.1365-313x.2006.02812.x
Arabidopsis SPA proteins regulate photoperiodic flowering and interact with the floral inducer CONSTANS to regulate its stability.2006 · DOI: 10.1242/dev.02481

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037649 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006281 DNA repair Biological Process
GO:0009585 red, far-red light phototransduction Biological Process
GO:0009637 response to blue light Biological Process
GO:0009640 photomorphogenesis Biological Process
GO:0009641 shade avoidance Biological Process
GO:0009647 skotomorphogenesis Biological Process
GO:0009649 entrainment of circadian clock Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process
GO:0010017 red or far-red light signaling pathway Biological Process
GO:0010100 negative regulation of photomorphogenesis Biological Process
GO:0010114 response to red light Biological Process
KEGG gene cross-reference
ath:AT1G53090
ath:AT2G32950
ath:AT2G46340
ath:AT3G15354
ath:AT4G11110
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.640
Rank 1 · TkAUNG022910 · TK1151
Cytoplasm0.346
Rank 2 · TkAUNG022910 · TK1151
Lysosome / Vacuole0.047
Rank 3 · TkAUNG022910 · TK1151
Cell membrane0.045
Rank 4 · TkAUNG022910 · TK1151
Golgi apparatus0.027
Rank 5 · TkAUNG022910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23419WD40_RFWD372-105 aa
PF24805EIF3I122-171 aa
PF23381Beta-prop_IFT122_1st133-169 aa
PF24807WD40_CDC20-Fz134-206 aa
PF25168Beta-prop_WDR36-Utp21_2nd134-170 aa
PF24782WD40_MABP1-WDR62_2nd136-169 aa
PF25047Beta-prop_TEP1_2nd139-233 aa
PF12894ANAPC4_WD40139-169 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG022910PF23419WD40_RFWD3721053.2e-0524.1
TkAUNG022910PF24805EIF3I1221712.1e-1454.1
TkAUNG022910PF23381Beta-prop_IFT122_1st1331694.3e-2795.9
TkAUNG022910PF24807WD40_CDC20-Fz1342063.3e-38132.4
TkAUNG022910PF25168Beta-prop_WDR36-Utp21_2nd1341701.1e-1351.9
TkAUNG022910PF24782WD40_MABP1-WDR62_2nd1361692e-1040.9
TkAUNG022910PF25047Beta-prop_TEP1_2nd1392333.3e-1763.2
TkAUNG022910PF12894ANAPC4_WD401391692.4e-0938.0
TkAUNG022910PF25173Beta-prop_WDR3_1st1402416e-36124.6
TkAUNG022910PF25175Beta-prop_WDR51403939e-34117.8
TkAUNG022910PF24817WD40_WDHD1_1st1402111.1e-2074.8
TkAUNG022910PF23414Beta-prop_EML_21402362.3e-1764.0
TkAUNG022910PF25172Beta-prop_WDR3_2nd1401766.7e-1555.8
TkAUNG022910PF23389Beta-prop_WDR19_1st1402591.3e-1041.6
TkAUNG022910PF23381Beta-prop_IFT122_1st1412084.3e-2795.9
TkAUNG022910PF23393Beta-prop_WDR90_POC16_2nd1411782.6e-0627.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9T014Arabidopsis thalianasp|Q9T014|SPA2_ARATH Protein SPA1-RELATED 262.300%Swiss-ProtHigh
Q9SYX2Arabidopsis thalianasp|Q9SYX2|SPA1_ARATH Protein SUPPRESSOR OF PHYA-105 158.200%Swiss-ProtHigh
Q94BM7Arabidopsis thalianasp|Q94BM7|SPA4_ARATH Protein SPA1-RELATED 450.000%Swiss-ProtHigh
Q9LJR3Arabidopsis thalianasp|Q9LJR3|SPA3_ARATH Protein SPA1-RELATED 348.100%Swiss-ProtMedium

JBrowse

View in Genome Browser