TkAUNG014080 | RubberDandelionOmics

Gene overview

TkAUNG014080

Reference: TK1151 Chr: ChrUn Coordinates: 3612825-3613408 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · TkAUNG014080|TK1151|cDNA

ATGCTAATCGATTACATAGCTTATAAGCTAAATTGGGAACCCTCTTTTATACGACAAAAGGTCTTTCCACTTGTGTCCACCATTTTCTTGAGAAACATAGCCAAAAATCAAGAAACCGGATTATTATACGGACAATATGAGTTTGACTTCATTCAAAGAACAAAGATAAGATTTGGGCATATGTTGTATGTGGTTACTTGGACAAAACACGGTCAAATAGTCAACAAGAACAATGTCCATACAACTACAACACATTTGGA...

CDS

Download CDS FASTA

507 bp · TkAUNG014080|TK1151|CDS

ATGCTAATCGATTACATAGCTTATAAGCTAAATTGGGAACCCTCTTTTATACGACAAAAGGTCTTTCCACTTGTGTCCACCATTTTCTTGAGAAACATAGCCAAAAATCAAGAAACCGGATTATTATACGGACAATATGAGTTTGACTTCATTCAAAGAACAAAGATAAGATTTGGGCATATGTTGTATGTGGTTACTTGGACAAAACACGGTCAAATAGTCAACAAGAACAATGTCCATACAACTACAACACATTTGGA...

Protein

Download Protein FASTA

168 aa · TkAUNG014080|TK1151|PROTEIN

MLIDYIAYKLNWEPSFIRQKVFPLVSTIFLRNIAKNQETGLLYGQYEFDFIQRTKIRFGHMLYVVTWTKHGQIVNKNNVHTTTTHLEDSQVQEWVMTDESVNNVHVDNGCLMTDENMDLVMAAYPEKVHQFMQQKESKESKSKKRGRAKSTSTPEGSRSVQLNITEFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG014080`
TK1151 ID	TkAUNG014080
OH-1004 ID	LXL04_002327
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 98.824 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG014080

Location ChrUn:3612825-3613408 (-)

Description Similar to RAD: Flap endonuclease GEN-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01880`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA with a specific cleavage site in the 5' overhang strand exactly one nucleotide 3' of the branch point.	AtGEN1 and AtSEND1, two paralogs in Arabidopsis, possess holliday junction resolvase activity.2014 · DOI: 10.1104/pp.114.237834

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0521900`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002327 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0009555 pollen development Biological Process

GO:0009650 UV protection Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003690 double-stranded DNA binding Molecular Function

GO:0003697 single-stranded DNA binding Molecular Function

GO:0008821 crossover junction DNA endonuclease activity Molecular Function

GO:0017108 5'-flap endonuclease activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0048256 flap endonuclease activity Molecular Function

KEGG gene cross-reference

ath:AT1G01880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.882

Rank 1 · TkAUNG014080 · TK1151

Cytoplasm0.219

Rank 2 · TkAUNG014080 · TK1151

Mitochondrion0.030

Rank 3 · TkAUNG014080 · TK1151

Cell membrane0.020

Rank 4 · TkAUNG014080 · TK1151

Extracellular0.014

Rank 5 · TkAUNG014080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18704Chromo_248-133 aa

PF25386Chromo_SEND159-69 aa

PF19105DUF579281-143 aa

PF25386Chromo_SEND1118-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG014080	`PF18704`	Chromo_2	48	133	9.2e-05	23.2
TkAUNG014080	`PF25386`	Chromo_SEND1	59	69	0.061	13.9
TkAUNG014080	`PF19105`	DUF5792	81	143	0.088	13.8
TkAUNG014080	`PF25386`	Chromo_SEND1	118	136	0.061	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPD2`	Arabidopsis thaliana	sp\|Q9LPD2\|GENL1_ARATH Flap endonuclease GEN-like 1	36.800%	Swiss-Prot	Medium
`Q64MA3`	Oryza sativa subsp. japonica	sp\|Q64MA3\|GENL1_ORYSJ Flap endonuclease GEN-like 1	35.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card