TkA08G257350 | RubberDandelionOmics

Gene overview

TkA08G257350

Reference: TK1151 Chr: Chr08 Coordinates: 67103496-67106949 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2164 bp · TkA08G257350|TK1151|cDNA

CTCAAATATTCGAATAGAACCAAAAAGAAAAAAAAAATACAAAGTTTTATGGACCGAGTCATGACTCGGCTGAAACGATCGTCTGACGCGCTCGCCGATGTTGACTTCCACCACCGTGATTCTTTTCCTCCTCCTCCTCCGCTTCCTACATGTGTGGGGGGAACGACTCCCAGACACTATTCTATCTCCTCCTCCTCCACGATTCCACGCGTCTTCATTCTCAGTGGATCCCACCTACCAATTCCCGAAGACCCAACAAC...

CDS

Download CDS FASTA

1830 bp · TkA08G257350|TK1151|CDS

ATGTTGACTTCCACCACCGTGATTCTTTTCCTCCTCCTCCTCCGCTTCCTACATGTGTGGGGGGAACGACTCCCAGACACTATTCTATCTCCTCCTCCTCCACGATTCCACGCGTCTTCATTCTCAGTGGATCCCACCTACCAATTCCCGAAGACCCAACAACCAGTTTCCCGAAATCCTTCCCACCCACCTATAAATTCCCAAATTCTCTCTCGCAAATCTCTCTCAGTTCATCGCACGGTCATGGTGCTGGAGAATTT...

Protein

Download Protein FASTA

609 aa · TkA08G257350|TK1151|PROTEIN

MLTSTTVILFLLLLRFLHVWGERLPDTILSPPPPRFHASSFSVDPTYQFPKTQQPVSRNPSHPPINSQILSRKSLSVHRTVMVLENFNSNGNASNLSSDNGCLDSLSLINSEKAVMEVIEQPLVQGIEDHLVEFSEAMRTVSKALRRAAEGKASAQAEASEWKRKYELERERNMQLENKDLKINPTENKVEKSAQNLKRMLERDEQSQIRSGKNGIYSHEVLRDNEHNSYSNIHSKLIRKASFKLHWCCTGEKNDQHKHD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G257350`
TK1151 ID	TkA08G257350
OH-1004 ID	LXL04_033449
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 98.686 / OH-1004 99.835 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G257350

Location Chr08:67103496-67106949 (-)

Description Similar to NADK1: NAD(H) kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21070`	Phosphorylates both NAD(+) and NADH, with a twofold preference for NADH.	No verified direct reference in this release
`At1g21640`	Involved in chlorophyll synthesis and chloroplast protection against oxidative damage.	NADK2, an Arabidopsis chloroplastic NAD kinase, plays a vital role in both chlorophyll synthesis and chloroplast protection.2005 · DOI: 10.1007/s11103-005-6802-y

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0957000`	Probable NAD kinase 1.	No verified direct reference in this release
`Os05g0388400`	Putative NAD kinase 3.	No verified direct reference in this release
`Os11g0191400`	Involved in chlorophyll synthesis and chloroplast protection against oxidative damage.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033449 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006741 NADP+ biosynthetic process Biological Process

GO:0019674 NAD+ metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003951 NAD+ kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042736 NADH kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G21640

ath:AT3G21070

dosa:Os01g0957000

dosa:Os11g0191400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.300

Rank 1 · TkA08G257350 · TK1151

Nucleus0.215

Rank 2 · TkA08G257350 · TK1151

Cell membrane0.157

Rank 3 · TkA08G257350 · TK1151

Mitochondrion0.146

Rank 4 · TkA08G257350 · TK1151

Golgi apparatus0.135

Rank 5 · TkA08G257350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27150Rv2240c107-151 aa

PF01513NAD_kinase172-204 aa

PF05826Phospholip_A2_2246-258 aa

PF01513NAD_kinase290-410 aa

PF00781DAGK_cat336-388 aa

PF20143NAD_kinase_C442-561 aa

PF05826Phospholip_A2_2453-488 aa

PF00781DAGK_cat465-476 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G257350	`PF27150`	Rv2240c	107	151	0.13	13.5
TkA08G257350	`PF01513`	NAD_kinase	172	204	6.7e-22	78.9
TkA08G257350	`PF05826`	Phospholip_A2_2	246	258	0.21	12.5
TkA08G257350	`PF01513`	NAD_kinase	290	410	6.7e-22	78.9
TkA08G257350	`PF00781`	DAGK_cat	336	388	0.00031	21.0
TkA08G257350	`PF20143`	NAD_kinase_C	442	561	1.1e-30	106.7
TkA08G257350	`PF05826`	Phospholip_A2_2	453	488	0.21	12.5
TkA08G257350	`PF00781`	DAGK_cat	465	476	0.00031	21.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56YN3`	Arabidopsis thaliana	sp\|Q56YN3\|NADK1_ARATH NAD(H) kinase 1	69.500%	Swiss-Prot	High
`Q9C5W3`	Arabidopsis thaliana	sp\|Q9C5W3\|NADK2_ARATH NAD kinase 2, chloroplastic	44.000%	Swiss-Prot	Medium
`Q5JK52`	Oryza sativa subsp. japonica	sp\|Q5JK52\|NADK1_ORYSJ Probable NAD kinase 1	67.600%	Swiss-Prot	High
`Q60E60`	Oryza sativa subsp. japonica	sp\|Q60E60\|NADK3_ORYSJ Putative NAD kinase 3	67.000%	Swiss-Prot	High
`Q53NI2`	Oryza sativa subsp. japonica	sp\|Q53NI2\|NADK2_ORYSJ Probable NAD kinase 2, chloroplastic	43.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card