LXL04_033449 | RubberDandelionOmics

Gene overview

LXL04_033449

Reference: OH-1004 Chr: Chr07 Coordinates: 44078310-44081408 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1824 bp · LXL04_033449|LXL04_033449|OH1004|cDNA

ATGTTGACTTCCACCACCGTGATTCTtttcctcctcctcctccgcTTCCTACATGTGTGGGGGGAACGACTCCCAGACACTATTCTATCTCCTCCTCCTCCACGATTCCACGCGTCTTCATTCTCAGTGGATCCCACCTACCAATTCCCGAAGACCCAACAACCAGTTTCCCGAAATCCTTCCCACCCACCTATAAATTCCCAAATTCTCTCTCGCAAATCTCTCTCAGTTCATCGCACGGTCATGGTGCTGGAGAATTT...

CDS

Download CDS FASTA

1824 bp · LXL04_033449|LXL04_033449|OH1004|CDS

ATGTTGACTTCCACCACCGTGATTCTTTTCCTCCTCCTCCTCCGCTTCCTACATGTGTGGGGGGAACGACTCCCAGACACTATTCTATCTCCTCCTCCTCCACGATTCCACGCGTCTTCATTCTCAGTGGATCCCACCTACCAATTCCCGAAGACCCAACAACCAGTTTCCCGAAATCCTTCCCACCCACCTATAAATTCCCAAATTCTCTCTCGCAAATCTCTCTCAGTTCATCGCACGGTCATGGTGCTGGAGAATTT...

Protein

Download Protein FASTA

607 aa · LXL04_033449|LXL04_033449|OH1004|PROTEIN

MLTSTTVILFLLLLRFLHVWGERLPDTILSPPPPRFHASSFSVDPTYQFPKTQQPVSRNPSHPPINSQILSRKSLSVHRTVMVLENFNSNGNASNLSSDNGCLDSLSLINSEKAVMEVIEQPLVQGIEDHLVEFSEAMRTVSKALRRAAEGKASAQAEASEWKRKYELERERNMQLENKVLGSIDLKINPTENKVEKSAQNLKRMLERDEQSQIRSGKNGIYSHEVLRDNEHNSYSNIHSKLIRKASFKLHWCCTGEKND...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033449`
TK1151 ID	TkA08G257350
OH-1004 ID	LXL04_033449
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 98.686 / OH-1004 99.835 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033449

Location Chr07:44078310-44081408 (-)

Description Similar to NADK1: NAD(H) kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21070`	Phosphorylates both NAD(+) and NADH, with a twofold preference for NADH.	No verified direct reference in this release
`At1g21640`	Involved in chlorophyll synthesis and chloroplast protection against oxidative damage.	NADK2, an Arabidopsis chloroplastic NAD kinase, plays a vital role in both chlorophyll synthesis and chloroplast protection.2005 · DOI: 10.1007/s11103-005-6802-y

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0957000`	Probable NAD kinase 1.	No verified direct reference in this release
`Os05g0388400`	Putative NAD kinase 3.	No verified direct reference in this release
`Os11g0191400`	Involved in chlorophyll synthesis and chloroplast protection against oxidative damage.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033449 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006741 NADP+ biosynthetic process Biological Process

GO:0019674 NAD+ metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003951 NAD+ kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042736 NADH kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G21640

ath:AT3G21070

dosa:Os01g0957000

dosa:Os11g0191400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.290

Rank 1 · LXL04_033449 · OH-1004

Nucleus0.206

Rank 2 · LXL04_033449 · OH-1004

Cell membrane0.157

Rank 3 · LXL04_033449 · OH-1004

Mitochondrion0.139

Rank 4 · LXL04_033449 · OH-1004

Golgi apparatus0.132

Rank 5 · LXL04_033449 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01513.27NAD_kinase295-415 aa

PF20143.5NAD_kinase_C447-566 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033449	`PF01513.27`	NAD_kinase	295	415	8.1e-22	78.6
LXL04_033449	`PF20143.5`	NAD_kinase_C	447	566	1.1e-30	106.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56YN3`	Arabidopsis thaliana	NAD(H) kinase 1	69.305%	Swiss-Prot	strong database homology
`Q9C5W3`	Arabidopsis thaliana	NAD kinase 2, chloroplastic	45.511%	Swiss-Prot	moderate database homology
`Q5JK52`	Oryza sativa subsp. japonica	Probable NAD kinase 1	69.838%	Swiss-Prot	strong database homology
`Q60E60`	Oryza sativa subsp. japonica	Putative NAD kinase 3	66.331%	Swiss-Prot	strong database homology
`Q53NI2`	Oryza sativa subsp. japonica	Probable NAD kinase 2, chloroplastic	46.440%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card