TkA08G254630 | RubberDandelionOmics

Gene overview

TkA08G254630

Reference: TK1151 Chr: Chr08 Coordinates: 66427618-66431091 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · TkA08G254630|TK1151|cDNA

ATGAAAGGATTAAGACTCGCATCTGAGGATAAAGAAAACCGTCCCTCCGATGCAAAGGAGATTGATCTCCAATTTTCACGGGAAGACCTCGAGACCATCAAAGTCATTGGAAAAGGAAGCGGAAGTATCGTTCAACTTGTTCGCCATAAATGGATCGGAAGACTGTTCGCTTTGAAGGTAATCCAGATGAACATACAAGAAGACATCCGCAAACAAATCGTTCAAGAACTTAAAATCAACCAAGCATCTCAATGCCCAAA...

CDS

Download CDS FASTA

762 bp · TkA08G254630|TK1151|CDS

ATGAAAGGATTAAGACTCGCATCTGAGGATAAAGAAAACCGTCCCTCCGATGCAAAGGAGATTGATCTCCAATTTTCACGGGAAGACCTCGAGACCATCAAAGTCATTGGAAAAGGAAGCGGAAGTATCGTTCAACTTGTTCGCCATAAATGGATCGGAAGACTGTTCGCTTTGAAGGTAATCCAGATGAACATACAAGAAGACATCCGCAAACAAATCGTTCAAGAACTTAAAATCAACCAAGCATCTCAATGCCCAAA...

Protein

Download Protein FASTA

253 aa · TkA08G254630|TK1151|PROTEIN

MKGLRLASEDKENRPSDAKEIDLQFSREDLETIKVIGKGSGSIVQLVRHKWIGRLFALKVIQMNIQEDIRKQIVQELKINQASQCPNIVVYYQSFYHNGAISLVFEYMDRGSLTDVIRQLKTILERYFVVLYKQVLQGLVYLHHERHVIHRDIKPSNLLANQKGQVKITDFGVSAMLSNSMRVSSLLEWLHNHTYELLSADMDQQSDIGNETPFLCLKTSQQHQQVYPNQNKNLKFQTPCLHQGGACEAPISF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G254630`
TK1151 ID	TkA08G254630
OH-1004 ID	LXL04_002480
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.900
Protein coverage (%)	TK1151 71.542 / OH-1004 37.552 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G254630

Location Chr08:66427618-66431091 (+)

Description Similar to MKK6: Mitogen-activated protein kinase kinase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56580`	The ANPs-MKK6-MPK4 module is involved in the regulation of plant cytokinesis during meiosis and mitosis.	NQK1/NtMEK1 is a MAPKK that acts in the NPK1 MAPKKK-mediated MAPK cascade and is required for plant cytokinesis.2003 · DOI: 10.1101/gad.1071103 The Arabidopsis thaliana MEK AtMKK6 activates the MAP kinase AtMPK13.2004 · DOI: 10.1016/j.febslet.2004.08.051 HINKEL kinesin, ANP MAPKKKs and MKK6/ANQ MAPKK, which phosphorylates and activates MPK4 MAPK, constitute a pathway that is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq135 The MAP kinase MPK4 is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.077164 AtMPK4 is required for male-specific meiotic cytokinesis in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04642.x AtMKK6 and AtMPK13 are required for lateral root formation in Arabidopsis.2011 · DOI: 10.4161/psb.6.10.17089
`At4g29810`	MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity.	The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023 The MAP kinase kinase MKK2 affects disease resistance in Arabidopsis.2007 · DOI: 10.1094/mpmi-20-5-0589 Arabidopsis mitogen-activated protein kinase kinases MKK1 and MKK2 have overlapping functions in defense signaling mediated by MEKK1, MPK4, and MKS1.2008 · DOI: 10.1104/pp.108.120006

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0510100`	Mitogen-activated protein kinase kinase 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002480 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006952 defense response Biological Process

GO:0007112 male meiosis cytokinesis Biological Process

GO:0007165 signal transduction Biological Process

GO:0010200 response to chitin Biological Process

GO:0010311 lateral root formation Biological Process

GO:0051707 response to other organism Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004708 MAP kinase kinase activity Molecular Function

GO:0004713 protein tyrosine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G56580

dosa:Os01g0510100

nta:107818847

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.573

Rank 1 · TkA08G254630 · TK1151

Nucleus0.472

Rank 2 · TkA08G254630 · TK1151

Mitochondrion0.070

Rank 3 · TkA08G254630 · TK1151

Cell membrane0.062

Rank 4 · TkA08G254630 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA08G254630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14531Kinase-like30-71 aa

PF00069Pkinase31-185 aa

PF07714PK_Tyr_Ser-Thr33-179 aa

PF10707YrbL-PhoP_reg58-83 aa

PF01636APH79-115 aa

PF03109ABC1103-186 aa

PF19703DUF6201113-134 aa

PF01163RIO1119-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G254630	`PF14531`	Kinase-like	30	71	0.011	15.7
TkA08G254630	`PF00069`	Pkinase	31	185	2e-40	139.6
TkA08G254630	`PF07714`	PK_Tyr_Ser-Thr	33	179	5.7e-22	79.0
TkA08G254630	`PF10707`	YrbL-PhoP_reg	58	83	0.038	14.4
TkA08G254630	`PF01636`	APH	79	115	0.023	15.2
TkA08G254630	`PF03109`	ABC1	103	186	6.4e-06	26.2
TkA08G254630	`PF19703`	DUF6201	113	134	0.082	13.6
TkA08G254630	`PF01163`	RIO1	119	179	0.05	13.9
TkA08G254630	`PF10707`	YrbL-PhoP_reg	131	198	0.038	14.4
TkA08G254630	`PF14531`	Kinase-like	134	172	0.011	15.7
TkA08G254630	`PF07387`	Seadorna_VP7	136	172	0.0062	16.3
TkA08G254630	`PF01636`	APH	143	166	0.023	15.2
TkA08G254630	`PF19703`	DUF6201	184	234	0.082	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJV0`	Arabidopsis thaliana	sp\|Q9FJV0\|M2K6_ARATH Mitogen-activated protein kinase kinase 6	75.300%	Swiss-Prot	High
`Q9S7U9`	Arabidopsis thaliana	sp\|Q9S7U9\|M2K2_ARATH Mitogen-activated protein kinase kinase 2	57.100%	Swiss-Prot	High
`Q5QN75`	Oryza sativa subsp. japonica	sp\|Q5QN75\|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1	62.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card