TkA08G093200 | RubberDandelionOmics

Gene overview

TkA08G093200

Reference: TK1151 Chr: Chr08 Coordinates: 24134188-24137638 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1719 bp · TkA08G093200|TK1151|cDNA

TTGATGTAAGGTGATGTTACTGTTTTGTCTTTGTGATCGCAGAAACCATAGGCTTTTATTTATTGCAATGGAAAGACCATTATTATTTTGATTATAAGTTTAGTGCTTAATTTGTCGATTTATTTATGTTGTCTGTTTCCTGGCCAAATGGGGGTCGTCGTCTTCTTTTAAACCCATGATGATCTTCTCTTTTCTCTTAAAATCGTATGATTTGATACCTTTTACCCCAAACCCACTTTACTTTAAATTACTTACTTTAG...

CDS

Download CDS FASTA

333 bp · TkA08G093200|TK1151|CDS

ATGGCATCGACATCCACATCCACGCAATTTGCAACATCAAGAAGGATGGGAATATACGAGCCACTGCCACTTCACCATATGGGTATGTGGGACGACACTTTCGGATGCGATATTAGTCCAAATACCGGGTCGTCTATCATCTCTCAAGTCAACAGGCTAGCCAATAAGGCAGAGTACGTTTCACAGGAGTCGATAGGACCTTCAGCGGATGATGAAGCAGCCAAAAACATGTCAGATAAGTTGCAAAGAAGGCTAGCACA...

Protein

Download Protein FASTA

110 aa · TkA08G093200|TK1151|PROTEIN

MASTSTSTQFATSRRMGIYEPLPLHHMGMWDDTFGCDISPNTGSSIISQVNRLANKAEYVSQESIGPSADDEAAKNMSDKLQRRLAQNREAARKSRLRKKAYVQQLETGR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G093200`
TK1151 ID	TkA08G093200
OH-1004 ID	LXL04_031192
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 30.220 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G093200

Location Chr08:24134188-24137638 (+)

Description Similar to TGA1: Transcription factor TGA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65210`	Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'.	No verified direct reference in this release
`At5g10030`	Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'.	No verified direct reference in this release
`At1g77920`	Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'.	No verified direct reference in this release
`At1g22070`	Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'.	Salicylic acid and NPR1 induce the recruitment of trans-activating TGA factors to a defense gene promoter in Arabidopsis.2003 · DOI: 10.1105/tpc.012211

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0637000`	Transcriptional regulator involved in defense response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031192 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G22070

ath:AT1G77920

ath:AT5G10030

ath:AT5G65210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · TkA08G093200 · TK1151

Cytoplasm0.121

Rank 2 · TkA08G093200 · TK1151

Cell membrane0.030

Rank 3 · TkA08G093200 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA08G093200 · TK1151

Plastid0.010

Rank 5 · TkA08G093200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11951Fungal_trans_21-87 aa

PF00170bZIP_151-57 aa

PF00170bZIP_179-108 aa

PF07716bZIP_279-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G093200	`PF11951`	Fungal_trans_2	1	87	0.0049	16.5
TkA08G093200	`PF00170`	bZIP_1	51	57	8.3e-10	39.3
TkA08G093200	`PF00170`	bZIP_1	79	108	8.3e-10	39.3
TkA08G093200	`PF07716`	bZIP_2	79	108	5.5e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39237`	Arabidopsis thaliana	sp\|Q39237\|TGA1_ARATH Transcription factor TGA1	53.500%	Swiss-Prot	High
`Q39162`	Arabidopsis thaliana	sp\|Q39162\|TGA4_ARATH Transcription factor TGA4	50.000%	Swiss-Prot	High
`Q93ZE2`	Arabidopsis thaliana	sp\|Q93ZE2\|TGA7_ARATH Transcription factor TGA7	48.000%	Swiss-Prot	Medium
`Q39234`	Arabidopsis thaliana	sp\|Q39234\|TGA3_ARATH Transcription factor TGA3	40.900%	Swiss-Prot	Medium
`A0A0P0WFC8`	Oryza sativa subsp. japonica	sp\|A0A0P0WFC8\|TGAL6_ORYSJ Transcription factor TGAL6	51.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card