LXL04_031192 | RubberDandelionOmics

Gene overview

LXL04_031192

Reference: OH-1004 Chr: Chr07 Coordinates: 2169912-2172109 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1095 bp · LXL04_031192|LXL04_031192|OH1004|cDNA

ATGGCATCGACATCCACATCCACGCAATTTGCAACATCAAGAAGGATGGGAATATACGAGCCACTGCCACTTCACCATATGGGTATGTGGGACGACACTTTCGGATGCGATATTAGTCCAAATACCGGGTCGTCTATCATCTCTCAAGTCAACAGGCTAGCCAATAAGGCAGAGTACGTTTCACAGGAGTCGATAGGACCTTCAGCGGATGATGAAGCAGCCAAAAACATGTCAGATAAGTTGCAAAGAAGGCTAGCACA...

CDS

Download CDS FASTA

1095 bp · LXL04_031192|LXL04_031192|OH1004|CDS

ATGGCATCGACATCCACATCCACGCAATTTGCAACATCAAGAAGGATGGGAATATACGAGCCACTGCCACTTCACCATATGGGTATGTGGGACGACACTTTCGGATGCGATATTAGTCCAAATACCGGGTCGTCTATCATCTCTCAAGTCAACAGGCTAGCCAATAAGGCAGAGTACGTTTCACAGGAGTCGATAGGACCTTCAGCGGATGATGAAGCAGCCAAAAACATGTCAGATAAGTTGCAAAGAAGGCTAGCACA...

Protein

Download Protein FASTA

364 aa · LXL04_031192|LXL04_031192|OH1004|PROTEIN

MASTSTSTQFATSRRMGIYEPLPLHHMGMWDDTFGCDISPNTGSSIISQVNRLANKAEYVSQESIGPSADDEAAKNMSDKLQRRLAQNREAARKSRLRKKAYVQQLETGRLKLAQLEQELERARQQRVYGGLMNSSNGLLPSNVNPGIAAFEMAYDLWVSEQQKKDSELKEVLQSHVSELELRIFVDSGLNHYYELFQMKANAAKADVFYIMNGSWRTPLERFFQWLGGPRPSELLYILMPQLEPLSNAQLVSVSTLKHS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031192`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031192

Location Chr07:2169912-2172109 (+)

Description Similar to TGA1: Transcription factor TGA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65210`	Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'.	No verified direct reference in this release
`At5g10030`	Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'.	No verified direct reference in this release
`At1g77920`	Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'.	No verified direct reference in this release
`At1g22070`	Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'.	Salicylic acid and NPR1 induce the recruitment of trans-activating TGA factors to a defense gene promoter in Arabidopsis.2003 · DOI: 10.1105/tpc.012211

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031192 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G22070

ath:AT1G77920

ath:AT5G10030

ath:AT5G65210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.769

Rank 1 · LXL04_031192 · OH-1004

Cytoplasm0.269

Rank 2 · LXL04_031192 · OH-1004

Cell membrane0.056

Rank 3 · LXL04_031192 · OH-1004

Endoplasmic reticulum0.036

Rank 4 · LXL04_031192 · OH-1004

Plastid0.023

Rank 5 · LXL04_031192 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00170.27bZIP_179-118 aa

PF14144.12DOG1167-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031192	`PF00170.27`	bZIP_1	79	118	2.6e-08	34.6
LXL04_031192	`PF14144.12`	DOG1	167	240	2.6e-25	89.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39237`	Arabidopsis thaliana	Transcription factor TGA1	56.522%	Swiss-Prot	strong database homology
`Q39162`	Arabidopsis thaliana	Transcription factor TGA4	56.319%	Swiss-Prot	strong database homology
`Q93ZE2`	Arabidopsis thaliana	Transcription factor TGA7	54.474%	Swiss-Prot	strong database homology
`Q39234`	Arabidopsis thaliana	Transcription factor TGA3	53.243%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card