TkA08G041650 | RubberDandelionOmics

Gene overview

TkA08G041650

Reference: TK1151 Chr: Chr08 Coordinates: 10603106-10610350 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5796 bp · TkA08G041650|TK1151|cDNA

AACGATACCTTATCCCAATTTAATTATTTTTGGGCAGTTCTTGTAGTTGGTCAAATGTCGTTTGTGACGAAAATAAGTGTCACGTGAAACGCACCGTCCAATTTTCGTCTATCGACAAACTTCTTTTCTATTCCCTTCATCTTTCTCCTTCTTCCTCTTCTTCTTTCTTCTTCTTTCCTCCCTTCTCATCGCGAGCTCAGAATCGTAAGCGACATAATTCCGTAGCAACATCCAATCGTATCAATCGGTGACAACATAGA...

CDS

Download CDS FASTA

1098 bp · TkA08G041650|TK1151|CDS

ATGATTCCATGCTGTCAGCATAGTTTCTGTGAAAAATGCATCTGTGATGTACTTCCACTGAAGTCAAAGTGCCCTAAATGTTCTTCTACCAAGTACAGGGTAGAACACTTGCTACCAAATTTATCCCTTAGGCATGCCATTGAGCATTTTCTTGAATCCCAACTTCTCGCCACTGCTCCAGAAGTTGATCTGCAGAAATACGTTCCAGATGGAGAATCTGGTATTCAGGGGAAAGAGGTTTCAACTAAAAGGAAATTGAA...

Protein

Download Protein FASTA

365 aa · TkA08G041650|TK1151|PROTEIN

MIPCCQHSFCEKCICDVLPLKSKCPKCSSTKYRVEHLLPNLSLRHAIEHFLESQLLATAPEVDLQKYVPDGESGIQGKEVSTKRKLNLLYSTEKGPNQNMAESVYESLNKKKVLMEGTGYHTGKSSAIDLLKNEDLTPCVDSEGENQPIIPQVMPNEGGDRGYAVNNRTKTCYMCGSPTHFIRDCPMASNENHMYHTGNQMFQGGMSGYPLPYWNTPVYPPVNPYMNMYGNPYSPSIIPVSPYGVPPYMASTYGNFPVHS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G041650`
TK1151 ID	TkA08G041650
OH-1004 ID	LXL04_017903
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 57.753 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G041650`
Location	Chr08:10603106-10610350 (+)
Description	Similar to At5g47430: E3 ubiquitin ligase PQT3-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017903` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006260 DNA replication Biological Process GO:0006275 regulation of DNA replication Biological Process GO:0006397 mRNA processing Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0010555 response to mannitol Biological Process GO:0016567 protein ubiquitination Biological Process GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0042542 response to hydrogen peroxide Biological Process
KEGG gene cross-reference	ath:AT4G17410 ath:AT5G47430 hsa:5930 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · TkA08G041650 · TK1151

Cytoplasm0.115

Rank 2 · TkA08G041650 · TK1151

Cell membrane0.022

Rank 3 · TkA08G041650 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA08G041650 · TK1151

Mitochondrion0.008

Rank 5 · TkA08G041650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14634zf-RING_52-28 aa

PF13923zf-C3HC4_24-27 aa

PF16685zf-RING_104-32 aa

PF13639zf-RING_24-27 aa

PF18551TackOD18-38 aa

PF00098zf-CCHC23-27 aa

PF13923zf-C3HC4_2129-139 aa

PF18551TackOD1166-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G041650	`PF14634`	zf-RING_5	2	28	0.59	10.9
TkA08G041650	`PF13923`	zf-C3HC4_2	4	27	0.0038	17.7
TkA08G041650	`PF16685`	zf-RING_10	4	32	0.088	13.7
TkA08G041650	`PF13639`	zf-RING_2	4	27	3.6	8.6
TkA08G041650	`PF18551`	TackOD1	8	38	0.74	10.1
TkA08G041650	`PF00098`	zf-CCHC	23	27	0.0018	19.0
TkA08G041650	`PF13923`	zf-C3HC4_2	129	139	0.0038	17.7
TkA08G041650	`PF18551`	TackOD1	166	193	0.74	10.1
TkA08G041650	`PF13639`	zf-RING_2	168	185	3.6	8.6
TkA08G041650	`PF14634`	zf-RING_5	169	176	0.59	10.9
TkA08G041650	`PF00098`	zf-CCHC	170	186	0.0018	19.0
TkA08G041650	`PF13923`	zf-C3HC4_2	171	186	0.0038	17.7
TkA08G041650	`PF13696`	zf-CCHC_2	172	187	0.0012	19.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card