TkA07G397510 | RubberDandelionOmics

Gene overview

TkA07G397510

Reference: TK1151 Chr: Chr07 Coordinates: 99874165-99876658 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1097 bp · TkA07G397510|TK1151|cDNA

CCAACTACACACATTATCAAGGGAAATCAATCATTTCATGAATAATTAATGGGGAGAGTAAAACTTCAGATCAAGAAAATAGAAAATACTACAAATAGGCAGGTGACTTTCTCAAAAAGAAGAAATGGATTGATCAAGAAAGCTTATGAACTATCTGTTCTATGTGATGTGGATGTTGCTCTCATCATGTTTTCCCCCTCAGGAAGAGCTAGCATTTTTTCTGGAAGTAGAAGTATCGAAGAAATTATGGGACGATATAT...

CDS

Download CDS FASTA

900 bp · TkA07G397510|TK1151|CDS

ATGGGGAGAGTAAAACTTCAGATCAAGAAAATAGAAAATACTACAAATAGGCAGGTGACTTTCTCAAAAAGAAGAAATGGATTGATCAAGAAAGCTTATGAACTATCTGTTCTATGTGATGTGGATGTTGCTCTCATCATGTTTTCCCCCTCAGGAAGAGCTAGCATTTTTTCTGGAAGTAGAAGTATCGAAGAAATTATGGGACGATATATAAATCTTCCAGAGCATGAAAGAGGAAGGTTGCAGAACCAAGAGCAACT...

Protein

Download Protein FASTA

299 aa · TkA07G397510|TK1151|PROTEIN

MGRVKLQIKKIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRASIFSGSRSIEEIMGRYINLPEHERGRLQNQEQLERALGRLKKESQDHQNHNQARNSSANADSQVQEIQQEIVRCKSQLMEMEKRLRIFEGDPSEITALCEAEYREQVLQESLKRVRHRKRALAEKYNSRDAESNTQASSINVSNMVTTNPSNIFDWLPPKDPQVQIMNFMNFNGIPPHRQNENVNRANVIDHDNNVNVQRSEFGQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G397510`
TK1151 ID	TkA07G397510
OH-1004 ID	LXL04_030322
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G397510

Location Chr07:99874165-99876658 (+)

Description Similar to AGL66: Agamous-like MADS-box protein AGL66

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22130`	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth.	MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.2009 · DOI: 10.1104/pp.109.135806
`At1g77980`	Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth.	MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.2009 · DOI: 10.1104/pp.109.135806
`At1g18750`	Probable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth.	MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.2009 · DOI: 10.1104/pp.109.135806
`At2g03060`	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth.	MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.2009 · DOI: 10.1104/pp.109.135806

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030322 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009555 pollen development Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010152 pollen maturation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G18750

ath:AT1G22130

ath:AT1G77980

ath:AT2G03060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA07G397510 · TK1151

Cytoplasm0.098

Rank 2 · TkA07G397510 · TK1151

Cell membrane0.020

Rank 3 · TkA07G397510 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA07G397510 · TK1151

Plastid0.010

Rank 5 · TkA07G397510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF10-54 aa

PF03961FapA14-135 aa

PF23204KIF21A_2nd59-87 aa

PF23203KIF21A63-152 aa

PF10386DUF244170-162 aa

PF07851TMEM120A-B81-139 aa

PF01486K-box83-105 aa

PF02601Exonuc_VII_L83-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G397510	`PF00319`	SRF-TF	10	54	7.6e-26	90.0
TkA07G397510	`PF03961`	FapA	14	135	0.52	10.6
TkA07G397510	`PF23204`	KIF21A_2nd	59	87	1.9	9.5
TkA07G397510	`PF23203`	KIF21A	63	152	0.24	11.9
TkA07G397510	`PF10386`	DUF2441	70	162	0.2	12.4
TkA07G397510	`PF07851`	TMEM120A-B	81	139	4.1	7.3
TkA07G397510	`PF01486`	K-box	83	105	0.0004	21.2
TkA07G397510	`PF02601`	Exonuc_VII_L	83	198	0.39	10.9
TkA07G397510	`PF01496`	V_ATPase_I	83	190	0.99	8.0
TkA07G397510	`PF09177`	STX6_10_61_N	84	168	0.062	14.6
TkA07G397510	`PF23204`	KIF21A_2nd	85	137	1.9	9.5
TkA07G397510	`PF15456`	Uds1	91	139	1.4	9.8
TkA07G397510	`PF07544`	Med9	105	182	0.11	13.3
TkA07G397510	`PF10203`	Pet191_N	106	140	0.16	12.9
TkA07G397510	`PF01486`	K-box	114	178	0.0004	21.2
TkA07G397510	`PF03961`	FapA	114	200	0.52	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM46`	Arabidopsis thaliana	sp\|Q9LM46\|AG104_ARATH Agamous-like MADS-box protein AGL104	50.300%	Swiss-Prot	Medium
`Q1PFC2`	Arabidopsis thaliana	sp\|Q1PFC2\|AGL66_ARATH Agamous-like MADS-box protein AGL66	46.600%	Swiss-Prot	Medium
`Q7X9I0`	Arabidopsis thaliana	sp\|Q7X9I0\|AGL65_ARATH Agamous-like MADS-box protein AGL65	43.700%	Swiss-Prot	Low
`Q1PFA4`	Arabidopsis thaliana	sp\|Q1PFA4\|AGL30_ARATH Agamous-like MADS-box protein AGL30	57.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card