LXL04_030322 | RubberDandelionOmics

Gene overview

LXL04_030322

Reference: OH-1004 Chr: Chr06 Coordinates: 114317228-114319540 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

900 bp · LXL04_030322|LXL04_030322|OH1004|cDNA

ATGGGGAGAGTAAAACTTCAGATCAAGAAAATAGAAAATACTACAAATAGGCAGGTGACTTTCTCAAAAAGAAGAAATGGATTGATCAAGAAAGCTTATGAACTATCTGTTCTATGTGATGTGGATGTTGCTCTCATCATGTTTTCCCCCTCAGGAAGAGCTAGCATTTTTTCTGGAAGTAGAAGTATCGAAGAAATTATGGGACGATATATAAATCTTCCAGAGCATGAAAGAGGAAGGTTGCAGAACCAAGAGCAACT...

CDS

Download CDS FASTA

900 bp · LXL04_030322|LXL04_030322|OH1004|CDS

ATGGGGAGAGTAAAACTTCAGATCAAGAAAATAGAAAATACTACAAATAGGCAGGTGACTTTCTCAAAAAGAAGAAATGGATTGATCAAGAAAGCTTATGAACTATCTGTTCTATGTGATGTGGATGTTGCTCTCATCATGTTTTCCCCCTCAGGAAGAGCTAGCATTTTTTCTGGAAGTAGAAGTATCGAAGAAATTATGGGACGATATATAAATCTTCCAGAGCATGAAAGAGGAAGGTTGCAGAACCAAGAGCAACT...

Protein

Download Protein FASTA

299 aa · LXL04_030322|LXL04_030322|OH1004|PROTEIN

MGRVKLQIKKIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRASIFSGSRSIEEIMGRYINLPEHERGRLQNQEQLERALGTLKKESQDHQNQNQARNSSANADSQVQEIQQEIVRCKSQLMEMEKRLRIFEGDPSEITALCEAEYREQVLQESLKRVRHRKRALAEKYNSRDAESNTQASSINVSNMVTTNPSNIFDWLPPKDPQVQIMNFMNFNGIPPHRQNENVNRANVIDHDNNVNVQRSEFGQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030322`
TK1151 ID	TkA07G397510
OH-1004 ID	LXL04_030322
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030322

Location Chr06:114317228-114319540 (+)

Description Similar to AGL66: Agamous-like MADS-box protein AGL66

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77980`	Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth.	MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.2009 · DOI: 10.1104/pp.109.135806
`At1g22130`	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth.	MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.2009 · DOI: 10.1104/pp.109.135806
`At1g18750`	Probable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth.	MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.2009 · DOI: 10.1104/pp.109.135806
`At2g03060`	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth.	MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.2009 · DOI: 10.1104/pp.109.135806

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030322 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009555 pollen development Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010152 pollen maturation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G18750

ath:AT1G22130

ath:AT1G77980

ath:AT2G03060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · LXL04_030322 · OH-1004

Cytoplasm0.100

Rank 2 · LXL04_030322 · OH-1004

Cell membrane0.020

Rank 3 · LXL04_030322 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_030322 · OH-1004

Plastid0.011

Rank 5 · LXL04_030322 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319.24SRF-TF10-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030322	`PF00319.24`	SRF-TF	10	54	7.5e-26	90.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PFC2`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL66	47.087%	Swiss-Prot	moderate database homology
`Q9LM46`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL104	45.022%	Swiss-Prot	moderate database homology
`Q7X9I0`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL65	31.803%	Swiss-Prot	moderate database homology
`Q1PFA4`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL30	29.934%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card