RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G152240
Reference: TK1151 Chr: Chr07 Coordinates: 39192564-39197452 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2766 bp · TkA07G152240|TK1151|cDNA

AAAAAGAGGAATAATTTTCTTTAAGCCTACTCAAGTTGCCATTGGCTCGAAGTCACTACTCACTGCTCAGCTCGTGAGACCGGCCCACGGTTCTTGACCCGCCGCCTTTATGAACCTCCTCGGAGACAGCCGACCGTTGGCGGACCGGCGACCGACCATAGACGACAACTACAAAGCTCAACCATGGAACTAAAATAGAGTCATATTGATGATGACCGAACATATAAGCAAATTCAGTGATCATTTACAAATCTCATTTC...

CDS

Download CDS FASTA

1863 bp · TkA07G152240|TK1151|CDS

ATGACTGGAGAAGAGACAAAAGAAGCTGGCAAGAACATCGGAAAATTTCTGCACTCAAAATGCAGTACACCAAAGTTATATTCAAAGAGACAAAGAAAAATAAAACCTCCAATGTCTAAAGAAAAGCTTGTTGAGTTTTTAACAAACACCAAAAGAAACGACTTCAAGAAAAGACGAAAGAGAAAGAAGACAGAAAACAAAATTGAAATTGATGAAGCTTCCAGACTGCAAACTCGGTCACGGAACCTTTTCACTAAATT...

Protein

Download Protein FASTA

620 aa · TkA07G152240|TK1151|PROTEIN

MTGEETKEAGKNIGKFLHSKCSTPKLYSKRQRKIKPPMSKEKLVEFLTNTKRNDFKKRRKRKKTENKIEIDEASRLQTRSRNLFTKLRREQNLLDAYSTEGWKGQSREKIKPEKELQRAKKQILKCKLGLRDALRQLDSLSTDGRIDESVIAPDGSVHHDHIHCAKCKLREAFPDNDIILCDGTCNCAFHQMCIDPPLLTENIPPGDQGWFCKYCICKTDIIDAMNAQLGTSYTNDTNWQEVFKDEATLPEGGETLQNQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G152240
TK1151 IDTkA07G152240
OH-1004 IDLXL04_017362
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)31.300
Protein coverage (%)TK1151 62.581 / OH-1004 72.424
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G152240
LocationChr07:39192564-39197452 (-)
DescriptionSimilar to HAZ1: Homeobox protein HAZ1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g29940 Specifically binds to the fungal elicitor-responsive DNA element, 5'-CTAATTGTTTA-3', of the gene PR2 promoter. No verified direct reference in this release
At3g19510 Binds only to large DNA fragments. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0229300 Transcriptional repressor involved in the regulation of gibberrelin (GA) signaling.
Rice homeobox transcription factor HOX1a positively regulates gibberellin responses by directly suppressing EL1.2011 · DOI: 10.1111/j.1744-7909.2011.01075.x
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017362 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006952 defense response Biological Process
GO:0009733 response to auxin Biological Process
GO:0009740 gibberellic acid mediated signaling pathway Biological Process
GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process
GO:0010557 positive regulation of macromolecule biosynthetic process Biological Process
GO:0045814 negative regulation of gene expression, epigenetic Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0005634 nucleus Cellular Component
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function
KEGG gene cross-reference
ath:AT3G19510
ath:AT4G29940
dosa:Os06g0229300
zma:542406
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964
Rank 1 · TkA07G152240 · TK1151
Cytoplasm0.117
Rank 2 · TkA07G152240 · TK1151
Cell membrane0.021
Rank 3 · TkA07G152240 · TK1151
Mitochondrion0.011
Rank 4 · TkA07G152240 · TK1151
Endoplasmic reticulum0.008
Rank 5 · TkA07G152240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00628PHD16-31 aa
PF21328Gp44_lid66-101 aa
PF06013WXG10071-130 aa
PF21328Gp44_lid130-151 aa
PF18892DUF5651163-189 aa
PF00628PHD164-215 aa
PF12993DUF3877380-459 aa
PF21328Gp44_lid390-403 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G152240PF00628PHD16311.6e-0731.9
TkA07G152240PF21328Gp44_lid661010.07913.9
TkA07G152240PF06013WXG100711300.1413.2
TkA07G152240PF21328Gp44_lid1301510.07913.9
TkA07G152240PF18892DUF56511631890.4711.1
TkA07G152240PF00628PHD1642151.6e-0731.9
TkA07G152240PF12993DUF38773804590.1312.7
TkA07G152240PF21328Gp44_lid3904030.07913.9
TkA07G152240PF00046Homeodomain4144624.2e-0936.8
TkA07G152240PF18892DUF56514234350.4711.1
TkA07G152240PF05920Homeobox_KN4344613.2e-0524.4
TkA07G152240PF12993DUF38775345830.1312.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P48785Arabidopsis thalianasp|P48785|PRH_ARATH Pathogenesis-related homeodomain protein52.700%Swiss-ProtHigh
Q04996Arabidopsis thalianasp|Q04996|HAT31_ARATH Homeobox protein HAT3.145.700%Swiss-ProtLow
Q8H991Oryza sativa subsp. japonicasp|Q8H991|HAZ1_ORYSJ Homeobox protein HAZ129.200%Swiss-ProtLow

JBrowse

View in Genome Browser