LXL04_017362 | RubberDandelionOmics

Gene overview

LXL04_017362

Reference: OH-1004 Chr: Chr03 Coordinates: 147464646-147467866 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1983 bp · LXL04_017362|LXL04_017362|OH1004|cDNA

ATGGCGAATCAAAAAAGCAACGAAGTGGTCAATGGAACTCCAAGTCATGAGCAATTGGAAGCAACTCAAGGAGACACAACCAAAAAATTAGGTCAACAAGGTACCAAGAAGAAAGGGCGAccaaagaaaaaagaaaatttgGGATCTCCGACAACTCCAAGGGTATTACGGTCAAGATCACAAGAGAAACCCAAACCTCCTGAATCAGTTGATGCATCTTCACAAAGTGTAGACAccaaagaaaagaagagaaagaaGAT...

CDS

Download CDS FASTA

1983 bp · LXL04_017362|LXL04_017362|OH1004|CDS

ATGGCGAATCAAAAAAGCAACGAAGTGGTCAATGGAACTCCAAGTCATGAGCAATTGGAAGCAACTCAAGGAGACACAACCAAAAAATTAGGTCAACAAGGTACCAAGAAGAAAGGGCGACCAAAGAAAAAAGAAAATTTGGGATCTCCGACAACTCCAAGGGTATTACGGTCAAGATCACAAGAGAAACCCAAACCTCCTGAATCAGTTGATGCATCTTCACAAAGTGTAGACACCAAAGAAAAGAAGAGAAAGAAGAT...

Protein

Download Protein FASTA

660 aa · LXL04_017362|LXL04_017362|OH1004|PROTEIN

MANQKSNEVVNGTPSHEQLEATQGDTTKKLGQQGTKKKGRPKKKENLGSPTTPRVLRSRSQEKPKPPESVDASSQSVDTKEKKRKKIIKKIKEDQNDEFSKIRKHLRYLLNKINYEKLFIDAYVGEGWKGQSLEKLRPEKELQRAKSDINRFKLRIRDLFQKIDKSCEEGRFPDTLYDSDGLIDSEDIFCAKCAQTEVKLDNDIILCDGFCDRGFHQFCLQPPLLKEQVPPGDEGWLCPACDCKVDCIDLLNDSMGTDLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017362`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017362

Location Chr03:147464646-147467866 (+)

Description Similar to HAZ1: Homeobox protein HAZ1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19510`	Binds only to large DNA fragments.	No verified direct reference in this release
`At4g29940`	Specifically binds to the fungal elicitor-responsive DNA element, 5'-CTAATTGTTTA-3', of the gene PR2 promoter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0229300`	Transcriptional repressor involved in the regulation of gibberrelin (GA) signaling.	Rice homeobox transcription factor HOX1a positively regulates gibberellin responses by directly suppressing EL1.2011 · DOI: 10.1111/j.1744-7909.2011.01075.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017362 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009733 response to auxin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010557 positive regulation of macromolecule biosynthetic process Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

KEGG gene cross-reference

ath:AT3G19510

ath:AT4G29940

dosa:Os06g0229300

zma:542406

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · LXL04_017362 · OH-1004

Cytoplasm0.141

Rank 2 · LXL04_017362 · OH-1004

Cell membrane0.018

Rank 3 · LXL04_017362 · OH-1004

Mitochondrion0.017

Rank 4 · LXL04_017362 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_017362 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00628.36PHD190-241 aa

PF00046.36Homeodomain535-577 aa

PF05920.18Homeobox_KN547-578 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017362	`PF00628.36`	PHD	190	241	3.6e-10	40.4
LXL04_017362	`PF00046.36`	Homeodomain	535	577	1.7e-09	38.1
LXL04_017362	`PF05920.18`	Homeobox_KN	547	578	1e-07	32.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q04996`	Arabidopsis thaliana	Homeobox protein HAT3.1	41.106%	Swiss-Prot	moderate database homology
`P48785`	Arabidopsis thaliana	Pathogenesis-related homeodomain protein	47.368%	Swiss-Prot	weak database homology
`Q8H991`	Oryza sativa subsp. japonica	Homeobox protein HAZ1	43.005%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card