TkA07G136030 | RubberDandelionOmics

Gene overview

TkA07G136030

Reference: TK1151 Chr: Chr07 Coordinates: 35247762-35249305 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1191 bp · TkA07G136030|TK1151|cDNA

CGAGGGTCCAAGTTTTACTCTAGACTCATCAAATCCTAACATACTTTAACACACCACCCCCAACTCTCTCTCTCTCTCTCTCTCTCTCTCTCCAACCAGGTCGTGGTTGGTGATTCTCTTTCTTTCATTCGTTCTTTATTTTCTGTAAATTTGTATCGATTTCCTTTCAATTTCTTGGCTTCTTTCTTTTTTGTTTTGGTAAGAAGAGGAGGAATAATTCATTGAGAATGACAGCGCCAAACATGGCGGCGATCACTGCA...

CDS

Download CDS FASTA

345 bp · TkA07G136030|TK1151|CDS

ATGACAGCGCCAAACATGGCGGCGATCACTGCATCCCTGGAAAGATCTCTTCAAAGCTTCTCTCTAAACAACCAAAGCAGCATCGGTGTCAGCGGCCGTGAAGGCTCCGGCTCCGGCATCGACAGGTCATCATCTTCCTCAGAGTCTCAGAATAATCGTTCAACAAACTCTTCCGACGCCACCTTGGAACTCAATTCAAATATAACACTTCCCTACCATTGGGAGCAATGCCTGGATTTAAAGACAGGGGAGGTGTATTA...

Protein

Download Protein FASTA

114 aa · TkA07G136030|TK1151|PROTEIN

MTAPNMAAITASLERSLQSFSLNNQSSIGVSGREGSGSGIDRSSSSSESQNNRSTNSSDATLELNSNITLPYHWEQCLDLKTGEVYYINWRTGMKSQEDPRTVDDGFSSYFYRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G136030`
TK1151 ID	TkA07G136030
OH-1004 ID	LXL04_028259
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.246 / OH-1004 51.376 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G136030

Location Chr07:35247762-35249305 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33510`	Negatively regulates the cuticle development by interacting with the HD-ZIP IV transcription factor HDG1.	CFL1, a WW domain protein, regulates cuticle development by modulating the function of HDG1, a class IV homeodomain transcription factor, in rice and Arabidopsis.2011 · DOI: 10.1105/tpc.111.088625 CFLAP1 and CFLAP2 Are Two bHLH Transcription Factors Participating in Synergistic Regulation of AtCFL1-Mediated Cuticle Development in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1005744
`At1g28070`	May negatively regulate the cuticle development by interacting with the HD-ZIP IV transcription factor HDG1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AIM8`	Negatively regulates the cuticle development probably by interacting with the HD-ZIP IV transcription factor HDG1.	No verified direct reference in this release
`Os02g0516400`	Negatively regulates the cuticle development probably by interacting with the HD-ZIP IV transcription factor HDG1.	CFL1, a WW domain protein, regulates cuticle development by modulating the function of HDG1, a class IV homeodomain transcription factor, in rice and Arabidopsis.2011 · DOI: 10.1105/tpc.111.088625

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028259 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0160062 cutin-based cuticle development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004386 helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28070

ath:AT2G33510

dosa:Os02g0516400

osa:4329477

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.522

Rank 1 · TkA07G136030 · TK1151

Nucleus0.513

Rank 2 · TkA07G136030 · TK1151

Cell membrane0.071

Rank 3 · TkA07G136030 · TK1151

Mitochondrion0.049

Rank 4 · TkA07G136030 · TK1151

Lysosome / Vacuole0.044

Rank 5 · TkA07G136030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30846CEP164_N69-100 aa

PF00397WW70-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G136030	`PF30846`	CEP164_N	69	100	0.0037	17.9
TkA07G136030	`PF00397`	WW	70	93	3.8e-05	24.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5HZ54`	Arabidopsis thaliana	sp\|Q5HZ54\|CFL1_ARATH Protein CURLY FLAG LEAF 1	52.400%	Swiss-Prot	High
`Q9C7E6`	Arabidopsis thaliana	sp\|Q9C7E6\|CFL2_ARATH Protein CURLY FLAG LEAF 2	43.800%	Swiss-Prot	Medium
`B8AIM8`	Oryza sativa subsp. indica	sp\|B8AIM8\|CFL1_ORYSI Protein CURLY FLAG LEAF 1	60.900%	Swiss-Prot	Low
`Q0E0W7`	Oryza sativa subsp. japonica	sp\|Q0E0W7\|CFL1_ORYSJ Protein CURLY FLAG LEAF 1	60.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card