TkA07G087890 | RubberDandelionOmics

Gene overview

TkA07G087890

Reference: TK1151 Chr: Chr07 Coordinates: 22937875-22940250 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · TkA07G087890|TK1151|cDNA

TCGGGCATGCTTATGAACCGCTCCACAGACCTGCCTTTATACCTTAATCACTTCCCAACTTTAAACCCATATCGATTCAATTGCTTTTTTCCTTTCTTCCTCTGATCATATCATCAGAATCCAACTGTAGATCATAATAAATTCAAGAGGTGTCGAAGATTGCCACTGTATTGATTTCACCGCAGGAGATCTTGTATAGAAACAATCATGTTTACCCGAGTGTTTGGAAAACCTAAGCAGGAATCTTCTAATGCTGTAAC...

CDS

Download CDS FASTA

654 bp · TkA07G087890|TK1151|CDS

ATGTTTACCCGAGTGTTTGGAAAACCTAAGCAGGAATCTTCTAATGCTGTAACATCATTAGACAAATTAAATGAGACACTTGAAATGCTGGAGAAGAAAGAAAGAGTACTTTTGAAGAAGGCTTCTGCGGAGGTGGAGAAGGCCAAAGACTATACTAGAGCGAAGAACAAAAAGGCGGCAATACAATGTTTAAAGAGGAAGAGACTCTACGAACAACAAATTGAGCAACTTGGCAACTTCCAATTACGTATTCATGACCA...

Protein

Download Protein FASTA

217 aa · TkA07G087890|TK1151|PROTEIN

MFTRVFGKPKQESSNAVTSLDKLNETLEMLEKKERVLLKKASAEVEKAKDYTRAKNKKAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDKTMDEINEQTENMKLIQEALATPMGAAADFDEDELEAELEELEGAELEEQLLQPATTAPVQVPAGRQQPLPAAPRKNTAEEDELAALQAEMAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G087890`
TK1151 ID	TkA07G087890
OH-1004 ID	LXL04_027715
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G087890

Location Chr07:22937875-22940250 (-)

Description Similar to VPS32.1: Vacuolar protein sorting-associated protein 32 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19830`	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release
`At4g29160`	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027715 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006900 vesicle budding from membrane Biological Process

GO:0007031 peroxisome organization Biological Process

GO:0007084 mitotic nuclear membrane reassembly Biological Process

GO:0010458 exit from mitosis Biological Process

GO:0015031 protein transport Biological Process

GO:0031468 nuclear membrane reassembly Biological Process

GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway Biological Process

GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

GO:0061709 reticulophagy Biological Process

GO:0070676 intralumenal vesicle formation Biological Process

KEGG gene cross-reference

ath:AT2G19830

ath:AT4G29160

dha:DEHA2D08844g

spo:2542922

xla:495125

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.718

Rank 1 · TkA07G087890 · TK1151

Nucleus0.299

Rank 2 · TkA07G087890 · TK1151

Cell membrane0.143

Rank 3 · TkA07G087890 · TK1151

Mitochondrion0.084

Rank 4 · TkA07G087890 · TK1151

Golgi apparatus0.073

Rank 5 · TkA07G087890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15341SLX910-79 aa

PF24611Spectrin_Anc-111-54 aa

PF14649Spatacsin_C13-78 aa

PF06103DUF94819-59 aa

PF03357Snf721-199 aa

PF14649Spatacsin_C109-158 aa

PF24611Spectrin_Anc-1113-144 aa

PF06103DUF948116-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G087890	`PF15341`	SLX9	10	79	7.6	7.7
TkA07G087890	`PF24611`	Spectrin_Anc-1	11	54	3.6	8.6
TkA07G087890	`PF14649`	Spatacsin_C	13	78	8.4	6.1
TkA07G087890	`PF06103`	DUF948	19	59	6.5	7.7
TkA07G087890	`PF03357`	Snf7	21	199	5.1e-46	157.2
TkA07G087890	`PF14649`	Spatacsin_C	109	158	8.4	6.1
TkA07G087890	`PF24611`	Spectrin_Anc-1	113	144	3.6	8.6
TkA07G087890	`PF06103`	DUF948	116	138	6.5	7.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82197`	Arabidopsis thaliana	sp\|O82197\|VP321_ARATH Vacuolar protein sorting-associated protein 32 homolog 1	81.300%	Swiss-Prot	High
`Q9SZE4`	Arabidopsis thaliana	sp\|Q9SZE4\|VP322_ARATH Vacuolar protein sorting-associated protein 32 homolog 2	74.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card