Gene Card
Gene overview
cDNA / CDS / Protein Sequences
654 bp · LXL04_027715|LXL04_027715|OH1004|cDNA
ATGTTTACCCGAGTGTTTGGAAAACCTAAGCAGGAATCTTCTAATGCTGTAACATCATTAGACAAATTAAATGAGACACTTGAAATGCTGGAGAAGAAAGAAAGAGTACTTTTGAAGAAGGCTTCTGCGGAGGTGGAGAAGGCCAAAGACTATACTAGAGCGAAGAACAAAAAGGCGGCAATACAATGTTTAAAGAGGAAGAGACTCTACGAACAACAAATTGAGCAACTTGGCAACTTCCAATTACGTATTCATGACCA...
654 bp · LXL04_027715|LXL04_027715|OH1004|CDS
ATGTTTACCCGAGTGTTTGGAAAACCTAAGCAGGAATCTTCTAATGCTGTAACATCATTAGACAAATTAAATGAGACACTTGAAATGCTGGAGAAGAAAGAAAGAGTACTTTTGAAGAAGGCTTCTGCGGAGGTGGAGAAGGCCAAAGACTATACTAGAGCGAAGAACAAAAAGGCGGCAATACAATGTTTAAAGAGGAAGAGACTCTACGAACAACAAATTGAGCAACTTGGCAACTTCCAATTACGTATTCATGACCA...
Protein
Download Protein FASTA217 aa · LXL04_027715|LXL04_027715|OH1004|PROTEIN
MFTRVFGKPKQESSNAVTSLDKLNETLEMLEKKERVLLKKASAEVEKAKDYTRAKNKKAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATNIDDVDKTMDEINEQTENMKLIQEALATPMGAAADFDEDELEAELEELEGAELEEQLLQPATTAPVQVPAGRQQPLPAAPRKNTAEEDELAALQAEMAL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_027715 |
|---|---|
| TK1151 ID | TkA07G087890 |
| OH-1004 ID | LXL04_027715 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_027715 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:22351060-22352840 (-) | |||||||||
| Description | Similar to VPS32.1: Vacuolar protein sorting-associated protein 32 homolog 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000281 mitotic cytokinesis Biological Process GO:0006900 vesicle budding from membrane Biological Process GO:0007031 peroxisome organization Biological Process GO:0007084 mitotic nuclear membrane reassembly Biological Process GO:0010458 exit from mitosis Biological Process GO:0015031 protein transport Biological Process GO:0031468 nuclear membrane reassembly Biological Process GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway Biological Process GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process GO:0045324 late endosome to vacuole transport Biological Process GO:0061709 reticulophagy Biological Process GO:0070676 intralumenal vesicle formation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G19830 ath:AT4G29160 dha:DEHA2D08844g spo:2542922 xla:495125 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03357.27Snf721-199 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_027715 | PF03357.27 | Snf7 | 21 | 199 | 5.1e-46 | 157.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.