RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G077500
Reference: TK1151 Chr: Chr07 Coordinates: 20157672-20166118 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

5796 bp · TkA07G077500|TK1151|cDNA

TGCAGGTTACCTTTTGAGCATCGTTGTAATTATTAACTTTTGTAATCAAAATCAAAATCTAAATCTAAATCTAAATCTAAATCTAAATCAAAGATGGAAACTTTACATCCGATTCCGTTTATGATGAGACAGTACCAGTGGCGTGTAGACCACAAGGGGAAAAAGACGCCCACTTTCGATCTTTTACTGGGTTAAAAAAGTCCCTTTGTCCTTTCTCTCCCGCTTCTCAGGTCCATAAATCATTCAACCTTCCATAATAT...

CDS

Download CDS FASTA

4851 bp · TkA07G077500|TK1151|CDS

ATGGGGTTTAAGCCCTTAGTTTCATACTGTCGTCCGGTGGAAAATGGTGTATGGGCGACGGCGGTGGAAAACGAATTTGGGCCTTACACACCTTGTGCAACCGATTCTCTGGTTACTGGCATTTCCCATTTGGTTCTCCTGGGAATTTGCATATGCCGATTATGGGTGACAACGAAGAATCTCAAAGTGCAGAGGTTCAAATTGAGGTCCAAAATCTACAATTACTTCTTGGGATTATTGGCTCTCTTCTGTACTGCTGA...

Protein

Download Protein FASTA

1616 aa · TkA07G077500|TK1151|PROTEIN

MGFKPLVSYCRPVENGVWATAVENEFGPYTPCATDSLVTGISHLVLLGICICRLWVTTKNLKVQRFKLRSKIYNYFLGLLALFCTAEPLIRLIMGISVFNVDGETGLAPYEIVTLVIKALAWCSVLIVLGIETVIYVCEIRWFMRFGVIYALLGDAVLLNLVLSVSQYYSRDILYIYSSEVGIQVVFGICLIVYLPTLDPYPGYSPIRVDPLDDGEYEELPSREEICPERHTNIISSIFFSWMNPLMLLGYKRPLTEKDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G077500
TK1151 IDTkA07G077500
OH-1004 IDLXL04_027600
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 99.692
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G077500
LocationChr07:20157672-20166118 (+)
DescriptionSimilar to ABCC2: ABC transporter C family member 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g34660 Pump for glutathione S-conjugates.
Enhanced multispecificity of arabidopsis vacuolar multidrug resistance-associated protein-type ATP-binding cassette transporter, AtMRP2.2001 · DOI: 10.1074/jbc.m009690200
AtMRP2, an Arabidopsis ATP binding cassette transporter able to transport glutathione S-conjugates and chlorophyll catabolites: functional comparisons with Atmrp1.1998 · DOI: 10.1105/tpc.10.2.267
At1g30400 Pump for glutathione S-conjugates.
AtMRP1 gene of Arabidopsis encodes a glutathione S-conjugate pump: isolation and functional definition of a plant ATP-binding cassette transporter gene.1997 · DOI: 10.1073/pnas.94.15.8243
At1g30410 Pump for glutathione S-conjugates. No verified direct reference in this release
At1g30420 Pump for glutathione S-conjugates. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027600 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0015700 arsenite transport Biological Process
GO:0015721 bile acid and bile salt transport Biological Process
GO:0046685 response to arsenic-containing substance Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0071716 leukotriene transport Biological Process
GO:1902418 (+)-abscisic acid D-glucopyranosyl ester transmembrane transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
KEGG gene cross-reference
ath:AT1G30400
ath:AT1G30410
ath:AT1G30420
ath:AT2G34660
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.448
Rank 1 · TkA07G077500 · TK1151
Lysosome / Vacuole0.237
Rank 2 · TkA07G077500 · TK1151
Cytoplasm0.151
Rank 3 · TkA07G077500 · TK1151
Endoplasmic reticulum0.145
Rank 4 · TkA07G077500 · TK1151
Golgi apparatus0.119
Rank 5 · TkA07G077500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664ABC_membrane307-571 aa
PF13481AAA_25622-663 aa
PF00005ABC_tran633-768 aa
PF09818ABC_ATPase639-663 aa
PF13555AAA_29644-664 aa
PF13191AAA_16644-679 aa
PF03193RsgA_GTPase644-667 aa
PF13476AAA_23644-663 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G077500PF00664ABC_membrane3075711.1e-63216.2
TkA07G077500PF13481AAA_256226630.1512.3
TkA07G077500PF00005ABC_tran6337683.7e-44151.4
TkA07G077500PF09818ABC_ATPase6396630.1611.7
TkA07G077500PF13555AAA_296446640.0003321.1
TkA07G077500PF13191AAA_166446790.0003421.9
TkA07G077500PF03193RsgA_GTPase6446670.001419.2
TkA07G077500PF13476AAA_236446630.02216.2
TkA07G077500PF20703nSTAND16446630.03514.5
TkA07G077500PF01935DUF876456676.1e-0523.9
TkA07G077500PF13401AAA_226456760.008717.1
TkA07G077500PF19993DO-GTPase26456620.08913.2
TkA07G077500PF13304AAA_216456630.2711.8
TkA07G077500PF01926MMR_HSR16466739.4e-0729.7
TkA07G077500PF00350Dynamin_N6466678.5e-0523.4
TkA07G077500PF10412TrwB_AAD_bind6466780.002417.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q42093Arabidopsis thalianasp|Q42093|AB2C_ARATH ABC transporter C family member 275.500%Swiss-ProtHigh
Q9C8G9Arabidopsis thalianasp|Q9C8G9|AB1C_ARATH ABC transporter C family member 173.400%Swiss-ProtHigh
Q9C8H0Arabidopsis thalianasp|Q9C8H0|AB12C_ARATH ABC transporter C family member 1269.300%Swiss-ProtHigh
Q9C8H1Arabidopsis thalianasp|Q9C8H1|AB11C_ARATH ABC transporter C family member 1166.600%Swiss-ProtHigh

JBrowse

View in Genome Browser