LXL04_027600 | RubberDandelionOmics

Gene overview

LXL04_027600

Reference: OH-1004 Chr: Chr06 Coordinates: 19918054-19925518 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4866 bp · LXL04_027600|LXL04_027600|OH1004|cDNA

ATGGGGTTTAAGCCCTTAGTTTCATACTGTCGTCCGGTGGAAAATGGTGTATGGGCGACGGCGGTGGAAAACGAATTTGGGCCTTACACACCTTGTGCAACCGATTCTCTGGTTACTGGCATTTCCCATTTGGTTCTCCTGGGAATTTGCATATGCCGATTATGGATGACAACGAAGAATCTCAAAGTGCAGCGGTTCAAATTGAGGTCCAAAATCTACAATTACTTCTTGGGATTATTGGCTCTCTTCTGTACTGCTGA...

CDS

Download CDS FASTA

4866 bp · LXL04_027600|LXL04_027600|OH1004|CDS

ATGGGGTTTAAGCCCTTAGTTTCATACTGTCGTCCGGTGGAAAATGGTGTATGGGCGACGGCGGTGGAAAACGAATTTGGGCCTTACACACCTTGTGCAACCGATTCTCTGGTTACTGGCATTTCCCATTTGGTTCTCCTGGGAATTTGCATATGCCGATTATGGATGACAACGAAGAATCTCAAAGTGCAGCGGTTCAAATTGAGGTCCAAAATCTACAATTACTTCTTGGGATTATTGGCTCTCTTCTGTACTGCTGA...

Protein

Download Protein FASTA

1621 aa · LXL04_027600|LXL04_027600|OH1004|PROTEIN

MGFKPLVSYCRPVENGVWATAVENEFGPYTPCATDSLVTGISHLVLLGICICRLWMTTKNLKVQRFKLRSKIYNYFLGLLALFCTAEPLIRLIMGISVFNVDGETGLAPYEIVTLVIKALAWCSVLIVLGIETVIYVCEIRWFMRFGVIYALLGDAVLLNLVLSVSQYYSRDILYIYSSEVGIQVVFGICLIVYLPTLDPYPGYSPIRVDPLDDGEYEELPSREEICPERHTNIISSIFFSWMNPLMLLGYKRPLTEKDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027600`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027600

Location Chr06:19918054-19925518 (+)

Description Similar to ABCC2: ABC transporter C family member 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34660`	Pump for glutathione S-conjugates.	Enhanced multispecificity of arabidopsis vacuolar multidrug resistance-associated protein-type ATP-binding cassette transporter, AtMRP2.2001 · DOI: 10.1074/jbc.m009690200 AtMRP2, an Arabidopsis ATP binding cassette transporter able to transport glutathione S-conjugates and chlorophyll catabolites: functional comparisons with Atmrp1.1998 · DOI: 10.1105/tpc.10.2.267
`At1g30400`	Pump for glutathione S-conjugates.	AtMRP1 gene of Arabidopsis encodes a glutathione S-conjugate pump: isolation and functional definition of a plant ATP-binding cassette transporter gene.1997 · DOI: 10.1073/pnas.94.15.8243
`At1g30410`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At1g30420`	Pump for glutathione S-conjugates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027600 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015700 arsenite transport Biological Process

GO:0015721 bile acid and bile salt transport Biological Process

GO:0046685 response to arsenic-containing substance Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0071716 leukotriene transport Biological Process

GO:1902418 (+)-abscisic acid D-glucopyranosyl ester transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT1G30400

ath:AT1G30410

ath:AT1G30420

ath:AT2G34660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.454

Rank 1 · LXL04_027600 · OH-1004

Lysosome / Vacuole0.231

Rank 2 · LXL04_027600 · OH-1004

Cytoplasm0.149

Rank 3 · LXL04_027600 · OH-1004

Endoplasmic reticulum0.145

Rank 4 · LXL04_027600 · OH-1004

Golgi apparatus0.117

Rank 5 · LXL04_027600 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane307-571 aa

PF00005.34ABC_tran633-768 aa

PF00664.29ABC_membrane915-1172 aa

PF00005.34ABC_tran1252-1400 aa

PF02463.26SMC_N1371-1440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027600	`PF00664.29`	ABC_membrane	307	571	1.5e-63	215.8
LXL04_027600	`PF00005.34`	ABC_tran	633	768	9.1e-44	150.1
LXL04_027600	`PF00664.29`	ABC_membrane	915	1172	1.5e-63	215.8
LXL04_027600	`PF00005.34`	ABC_tran	1252	1400	9.1e-44	150.1
LXL04_027600	`PF02463.26`	SMC_N	1371	1440	6.9e-11	42.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42093`	Arabidopsis thaliana	ABC transporter C family member 2	75.385%	Swiss-Prot	strong database homology
`Q9C8G9`	Arabidopsis thaliana	ABC transporter C family member 1	73.276%	Swiss-Prot	strong database homology
`Q9C8H0`	Arabidopsis thaliana	ABC transporter C family member 12	69.246%	Swiss-Prot	strong database homology
`Q9C8H1`	Arabidopsis thaliana	ABC transporter C family member 11	66.622%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card