TkA07G037000 | RubberDandelionOmics

Gene overview

TkA07G037000

Reference: TK1151 Chr: Chr07 Coordinates: 9853199-9855282 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1806 bp · TkA07G037000|TK1151|cDNA

ATGGGTATGGCTCTTAGAAGATCTGGTGTTATAAACCGTATATGCATAAGATGCTTGTATGTCTTGATAATTGCATTACAACATATCAAGGGAACTGATATATTGACAAAAGATAGTCCGCTCTTCTCAGGAGAGACTCTAGTCTCTTCCAATCAAATCTTTGAGTTAGGCTTCTTCACTCCAGGTAATTCCACTAACCAATATCTTGGTCTATGGTTCAAAGATATTCTTCCAAGAAAAATTCTATGGGTTGCAAACAG...

CDS

Download CDS FASTA

1806 bp · TkA07G037000|TK1151|CDS

ATGGGTATGGCTCTTAGAAGATCTGGTGTTATAAACCGTATATGCATAAGATGCTTGTATGTCTTGATAATTGCATTACAACATATCAAGGGAACTGATATATTGACAAAAGATAGTCCGCTCTTCTCAGGAGAGACTCTAGTCTCTTCCAATCAAATCTTTGAGTTAGGCTTCTTCACTCCAGGTAATTCCACTAACCAATATCTTGGTCTATGGTTCAAAGATATTCTTCCAAGAAAAATTCTATGGGTTGCAAACAG...

Protein

Download Protein FASTA

601 aa · TkA07G037000|TK1151|PROTEIN

MGMALRRSGVINRICIRCLYVLIIALQHIKGTDILTKDSPLFSGETLVSSNQIFELGFFTPGNSTNQYLGLWFKDILPRKILWVANRQNPISFSNTNSILTIGNDGNLRILDANQTTVWSTRLRVQSNKTIAKLTNIGDFTLNDTISGLTFWKSFDHPSNILLPGMRLGTNETTQGKNLLTSWKSSDDPTPGDFVLGLSEEQPPQAFTWRGSKPYWRSGPWDAGKFIGIPEQDPGYSNRMTLMPENSQGGAYLTINLHSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G037000`
TK1151 ID	TkA07G037000
OH-1004 ID	LXL04_027170
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G037000

Location Chr07:9853199-9855282 (-)

Description Similar to At1g61550: G-type lectin S-receptor-like serine/threonine-protein kinase At1g61550

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61480`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61480.	No verified direct reference in this release
`At1g61550`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61550.	No verified direct reference in this release
`At1g61500`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61500.	No verified direct reference in this release
`At1g61370`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61370.	No verified direct reference in this release
`At1g61390`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61390.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027170 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0045087 innate immune response Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G61370

ath:AT1G61390

ath:AT1G61440

ath:AT1G61480

ath:AT1G61550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.799

Rank 1 · TkA07G037000 · TK1151

Endoplasmic reticulum0.090

Rank 2 · TkA07G037000 · TK1151

Cytoplasm0.069

Rank 3 · TkA07G037000 · TK1151

Extracellular0.057

Rank 4 · TkA07G037000 · TK1151

Nucleus0.034

Rank 5 · TkA07G037000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin81-184 aa

PF00954S_locus_glycop94-128 aa

PF12779WXXGXW208-221 aa

PF00954S_locus_glycop216-320 aa

PF08276PAN_2297-311 aa

PF08276PAN_2356-413 aa

PF01453B_lectin481-500 aa

PF00069Pkinase515-598 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G037000	`PF01453`	B_lectin	81	184	8.9e-29	100.7
TkA07G037000	`PF00954`	S_locus_glycop	94	128	3.3e-21	76.6
TkA07G037000	`PF12779`	WXXGXW	208	221	4.8	8.1
TkA07G037000	`PF00954`	S_locus_glycop	216	320	3.3e-21	76.6
TkA07G037000	`PF08276`	PAN_2	297	311	6e-15	55.8
TkA07G037000	`PF08276`	PAN_2	356	413	6e-15	55.8
TkA07G037000	`PF01453`	B_lectin	481	500	8.9e-29	100.7
TkA07G037000	`PF00069`	Pkinase	515	598	3.4e-11	43.8
TkA07G037000	`PF07714`	PK_Tyr_Ser-Thr	517	599	3.1e-14	53.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64771`	Arabidopsis thaliana	sp\|O64771\|Y1148_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61480	43.700%	Swiss-Prot	Medium
`Q9SY95`	Arabidopsis thaliana	sp\|Q9SY95\|Y1155_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61550	43.700%	Swiss-Prot	Medium
`Q9SYA0`	Arabidopsis thaliana	sp\|Q9SYA0\|Y1150_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61500	42.000%	Swiss-Prot	Medium
`O64783`	Arabidopsis thaliana	sp\|O64783\|Y1137_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61370	42.700%	Swiss-Prot	Medium
`O64781`	Arabidopsis thaliana	sp\|O64781\|Y1639_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61390	41.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card