LXL04_027170 | RubberDandelionOmics

Gene overview

LXL04_027170

Reference: OH-1004 Chr: Chr06 Coordinates: 10145116-10147154 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1755 bp · LXL04_027170|LXL04_027170|OH1004|cDNA

ATGGGTATGGCTCTTAGAAGATCTGGTGTTATAAACCGTATATGCATAAGATGCTTGTATGTCTTGATAATTGCATTACAACATATCAAGGGAACTGATATATTGACAAAAGATAGTCCGCTCTTCTCAGGAGAGACTCTAGTCTCTTCCAATCAAATCTTTGAGTTAGGCTTCTTCACTCCAGGTAATTCCACTAACCAATATCTTGGTCTATGGTTCAAAGATATTCTTCCAAGAAAAATTCTATGGGTTGCAAACAG...

CDS

Download CDS FASTA

1755 bp · LXL04_027170|LXL04_027170|OH1004|CDS

ATGGGTATGGCTCTTAGAAGATCTGGTGTTATAAACCGTATATGCATAAGATGCTTGTATGTCTTGATAATTGCATTACAACATATCAAGGGAACTGATATATTGACAAAAGATAGTCCGCTCTTCTCAGGAGAGACTCTAGTCTCTTCCAATCAAATCTTTGAGTTAGGCTTCTTCACTCCAGGTAATTCCACTAACCAATATCTTGGTCTATGGTTCAAAGATATTCTTCCAAGAAAAATTCTATGGGTTGCAAACAG...

Protein

Download Protein FASTA

584 aa · LXL04_027170|LXL04_027170|OH1004|PROTEIN

MGMALRRSGVINRICIRCLYVLIIALQHIKGTDILTKDSPLFSGETLVSSNQIFELGFFTPGNSTNQYLGLWFKDILPRKILWVANRQNPISFSNTNSILTIGNDGNLRILDANQTTVWSTRLTGPLTNIGDFTLNDTISGLTFWKSFDHPSNILLPGMRLGTNETTQGKNLLTSWKSSDDPTPGDFVLGLSEEQPPQAFTWRGSKPYWRSGPWDAGKFIGIPEQDPGYSNRMTLMPENSQGGSYLTINLHSSFDTRWLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027170`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027170

Location Chr06:10145116-10147154 (-)

Description Similar to At1g61550: G-type lectin S-receptor-like serine/threonine-protein kinase At1g61550

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61550`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61550.	No verified direct reference in this release
`At1g61480`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61480.	No verified direct reference in this release
`At1g61370`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61370.	No verified direct reference in this release
`At1g61440`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61440.	No verified direct reference in this release
`At1g61390`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61390.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027170 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0045087 innate immune response Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G61370

ath:AT1G61390

ath:AT1G61440

ath:AT1G61480

ath:AT1G61550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.650

Rank 1 · LXL04_027170 · OH-1004

Endoplasmic reticulum0.117

Rank 2 · LXL04_027170 · OH-1004

Extracellular0.107

Rank 3 · LXL04_027170 · OH-1004

Cytoplasm0.078

Rank 4 · LXL04_027170 · OH-1004

Lysosome / Vacuole0.045

Rank 5 · LXL04_027170 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453.31B_lectin81-177 aa

PF00954.26S_locus_glycop209-313 aa

PF08276.18PAN_2349-406 aa

PF07714.24PK_Tyr_Ser-Thr499-582 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027170	`PF01453.31`	B_lectin	81	177	6.2e-24	85.2
LXL04_027170	`PF00954.26`	S_locus_glycop	209	313	2.8e-21	76.8
LXL04_027170	`PF08276.18`	PAN_2	349	406	5.8e-15	55.9
LXL04_027170	`PF07714.24`	PK_Tyr_Ser-Thr	499	582	4.3e-07	30.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY95`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61550	42.430%	Swiss-Prot	moderate database homology
`O64771`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61480	41.446%	Swiss-Prot	moderate database homology
`O64783`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61370	40.885%	Swiss-Prot	moderate database homology
`O64776`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61440	42.295%	Swiss-Prot	moderate database homology
`O64781`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61390	40.198%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card