TkA07G026940 | RubberDandelionOmics

Gene overview

TkA07G026940

Reference: TK1151 Chr: Chr07 Coordinates: 7267515-7272188 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2480 bp · TkA07G026940|TK1151|cDNA

CTTTGCATTACTTACCGATAGGAACCCAAAGCTCTTTCATTGTATTAACAATGGGAGTTTCTTGGCAATTTGGATTTGTTATTCTATTTTTGCTTTGTAACATTTGTGTCGCAGAAGAACGTAATATATACATGGTGATGGTAGAAGGCGATCCACCCGTTGCGTTTTTTCAAGATAGCAAAGTGTCTCGTCAGTCTGGCGAAAAAATTGACTTTGATAGTGAAGTATTAAAGGCTCACGCAAAACACCTGGAAGACTCT...

CDS

Download CDS FASTA

2430 bp · TkA07G026940|TK1151|CDS

ATGGGAGTTTCTTGGCAATTTGGATTTGTTATTCTATTTTTGCTTTGTAACATTTGTGTCGCAGAAGAACGTAATATATACATGGTGATGGTAGAAGGCGATCCACCCGTTGCGTTTTTTCAAGATAGCAAAGTGTCTCGTCAGTCTGGCGAAAAAATTGACTTTGATAGTGAAGTATTAAAGGCTCACGCAAAACACCTGGAAGACTCTCATGATCATCTTCTCCAATCCACATTAGACGAAGGAGCTTACACCAAGCT...

Protein

Download Protein FASTA

810 aa · TkA07G026940|TK1151|PROTEIN

MGVSWQFGFVILFLLCNICVAEERNIYMVMVEGDPPVAFFQDSKVSRQSGEKIDFDSEVLKAHAKHLEDSHDHLLQSTLDEGAYTKLYSYKHLVNGFSVHTTPSQAKKLKKAPGVKLIEKDTGVKKMTTHTPNFLGLPQGVWTTEGGDSNAGEGVLIGFVDSGINPFHPSFAYDPIDGRNPNNQRKFPEVCDVGPHFPKSSCNGKIVSARFFAAGVQASGKFNATTDILSPFDSDGHGSHTASTAAGNYGVPVVVQGSYY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G026940`
TK1151 ID	TkA07G026940
OH-1004 ID	LXL04_027035
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 98.901 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G026940

Location Chr07:7267515-7272188 (+)

Description Similar to SBT2.4: Subtilisin-like protease SBT2.4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62340`	Serine protease required for epidermal surface formation in embryos and juvenile plants.	A subtilisin-like serine protease is required for epidermal surface formation in Arabidopsis embryos and juvenile plants.2001 · DOI: 10.1242/dev.128.23.4681 Novel receptor-like kinase ALE2 controls shoot development by specifying epidermis in Arabidopsis.2007 · DOI: 10.1242/dev.003533
`At2g19170`	Subtilisin-like protease SBT2.5.	No verified direct reference in this release
`At4g30020`	Subtilisin-like protease SBT2.6.	No verified direct reference in this release
`At5g44530`	Subtilisin-like protease SBT2.3.	No verified direct reference in this release
`At4g20430`	Subtilisin-like protease SBT2.2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027035 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0090558 plant epidermis development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0008236 serine-type peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G62340

ath:AT2G19170

ath:AT4G20430

ath:AT4G30020

ath:AT5G44530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.613

Rank 1 · TkA07G026940 · TK1151

Lysosome / Vacuole0.157

Rank 2 · TkA07G026940 · TK1151

Cytoplasm0.085

Rank 3 · TkA07G026940 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA07G026940 · TK1151

Cell membrane0.051

Rank 5 · TkA07G026940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922Inhibitor_I960-125 aa

PF21864MORF_dom80-126 aa

PF00082Peptidase_S8152-640 aa

PF17766fn3_6720-810 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G026940	`PF05922`	Inhibitor_I9	60	125	2e-13	51.6
TkA07G026940	`PF21864`	MORF_dom	80	126	0.056	14.0
TkA07G026940	`PF00082`	Peptidase_S8	152	640	5.5e-44	151.3
TkA07G026940	`PF17766`	fn3_6	720	810	5.6e-17	62.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HYR6`	Arabidopsis thaliana	sp\|F4HYR6\|SBT24_ARATH Subtilisin-like protease SBT2.4	55.800%	Swiss-Prot	High
`O64481`	Arabidopsis thaliana	sp\|O64481\|SBT25_ARATH Subtilisin-like protease SBT2.5	45.700%	Swiss-Prot	Medium
`Q9SZV5`	Arabidopsis thaliana	sp\|Q9SZV5\|SBT26_ARATH Subtilisin-like protease SBT2.6	45.500%	Swiss-Prot	Medium
`Q9FI12`	Arabidopsis thaliana	sp\|Q9FI12\|SBT23_ARATH Subtilisin-like protease SBT2.3	43.200%	Swiss-Prot	Medium
`Q9SUN6`	Arabidopsis thaliana	sp\|Q9SUN6\|SBT22_ARATH Subtilisin-like protease SBT2.2	43.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card