LXL04_027035 | RubberDandelionOmics

Gene overview

LXL04_027035

Reference: OH-1004 Chr: Chr06 Coordinates: 7485625-7490300 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2460 bp · LXL04_027035|LXL04_027035|OH1004|cDNA

ATGGGAGTTTCTTGGCAATTTGGATTTGTTATTCTATTTTTGCTTTGTAACATTTGTGTCGCAGAAGAACGTAATATATACATGGTGATGGTAGAAGGCGATCCACCCGTTGCGTTTTTTCAAGATAGCAAAGTGTCTCGTCAGTCTGGCGAAAAAATTGACTTTGATAGTGAAGTATTAAAGGCTCACGCAAAACACCTGGAAGACTCTCATGATCATCTTCTCCAATCCACATTAGACGAAGGAGCTTACACCAAGCT...

CDS

Download CDS FASTA

2460 bp · LXL04_027035|LXL04_027035|OH1004|CDS

ATGGGAGTTTCTTGGCAATTTGGATTTGTTATTCTATTTTTGCTTTGTAACATTTGTGTCGCAGAAGAACGTAATATATACATGGTGATGGTAGAAGGCGATCCACCCGTTGCGTTTTTTCAAGATAGCAAAGTGTCTCGTCAGTCTGGCGAAAAAATTGACTTTGATAGTGAAGTATTAAAGGCTCACGCAAAACACCTGGAAGACTCTCATGATCATCTTCTCCAATCCACATTAGACGAAGGAGCTTACACCAAGCT...

Protein

Download Protein FASTA

819 aa · LXL04_027035|LXL04_027035|OH1004|PROTEIN

MGVSWQFGFVILFLLCNICVAEERNIYMVMVEGDPPVAFFQDSKVSRQSGEKIDFDSEVLKAHAKHLEDSHDHLLQSTLDEGAYTKLYSYKHLVNGFSVHTTPSQAKKLNKAPGVKLIEKDTGVKKMTTHTPNFLGLPQGVWTTEGGDSNAGEGVLIGFVDSGINPFHPSFAYDPTDGRNPKNRRKFPEVCDVGPHFPKSSCNGKIVSARFFAAGVQASGKFNATTDILSPFDSDGHGSHTASTAAGNFGVPVVVQGSYY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027035`
TK1151 ID	TkA07G026940
OH-1004 ID	LXL04_027035
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 98.901 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027035

Location Chr06:7485625-7490300 (+)

Description Similar to SBT2.4: Subtilisin-like protease SBT2.4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62340`	Serine protease required for epidermal surface formation in embryos and juvenile plants.	A subtilisin-like serine protease is required for epidermal surface formation in Arabidopsis embryos and juvenile plants.2001 · DOI: 10.1242/dev.128.23.4681 Novel receptor-like kinase ALE2 controls shoot development by specifying epidermis in Arabidopsis.2007 · DOI: 10.1242/dev.003533
`At2g19170`	Subtilisin-like protease SBT2.5.	No verified direct reference in this release
`At4g30020`	Subtilisin-like protease SBT2.6.	No verified direct reference in this release
`At5g44530`	Subtilisin-like protease SBT2.3.	No verified direct reference in this release
`At4g20430`	Subtilisin-like protease SBT2.2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027035 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0090558 plant epidermis development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0008236 serine-type peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G62340

ath:AT2G19170

ath:AT4G20430

ath:AT4G30020

ath:AT5G44530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.607

Rank 1 · LXL04_027035 · OH-1004

Lysosome / Vacuole0.152

Rank 2 · LXL04_027035 · OH-1004

Cytoplasm0.085

Rank 3 · LXL04_027035 · OH-1004

Endoplasmic reticulum0.068

Rank 4 · LXL04_027035 · OH-1004

Cell membrane0.055

Rank 5 · LXL04_027035 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922.22Inhibitor_I960-125 aa

PF00082.28Peptidase_S8152-640 aa

PF17766.8fn3_6720-814 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027035	`PF05922.22`	Inhibitor_I9	60	125	4.5e-13	50.4
LXL04_027035	`PF00082.28`	Peptidase_S8	152	640	1.7e-43	149.7
LXL04_027035	`PF17766.8`	fn3_6	720	814	9.8e-19	68.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HYR6`	Arabidopsis thaliana	Subtilisin-like protease SBT2.4	54.655%	Swiss-Prot	strong database homology
`O64481`	Arabidopsis thaliana	Subtilisin-like protease SBT2.5	46.010%	Swiss-Prot	moderate database homology
`Q9SZV5`	Arabidopsis thaliana	Subtilisin-like protease SBT2.6	45.532%	Swiss-Prot	moderate database homology
`Q9FI12`	Arabidopsis thaliana	Subtilisin-like protease SBT2.3	42.206%	Swiss-Prot	moderate database homology
`Q9SUN6`	Arabidopsis thaliana	Subtilisin-like protease SBT2.2	43.651%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card