TkA06G447200 | RubberDandelionOmics

Gene overview

TkA06G447200

Reference: TK1151 Chr: Chr06 Coordinates: 110498470-110502528 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2149 bp · TkA06G447200|TK1151|cDNA

AAATAGCACCCTGCTCATAGTCACAGGTCGACCGGTAAAAGTGGAAGAAATTGCAGCAAAATTGAACCCGAAGACCGGTTTTCCATATACCCATCGTCGGTGTTACACCTGCTGCGGTGCCGGAAACCACCGTTCTACCAATTCCGCCTCATTCTCTGCCGTACATTTGACCACCGCATCCAGTTTGATCTGTGAATTGGATAGAGGAACCATAAAAGCTCGGGACTGATACCGAGGATTTTGTTCGATCTACAATGGCT...

CDS

Download CDS FASTA

1758 bp · TkA06G447200|TK1151|CDS

ATGGCTTCAGACTCCAACTCATCATCATCTCAACCTCCAACTGAAGCTACTGATGTTGAAACTTGTGCATCCACCATCTCTGACCAGACTAACAATTCTACAATTGACCCTTCCCCTTCCCCTTCCCTTGCCCCTGCCCCCATGGAAACTCCACCACCTGTTATATCATCATCAGATGGAGTTCCAAATTTCCCCAAACCTACATCACCAAGACAAACCCCTTCACAATCTGAAACCATCGGAAAGTGGACGATTGCACA...

Protein

Download Protein FASTA

585 aa · TkA06G447200|TK1151|PROTEIN

MASDSNSSSSQPPTEATDVETCASTISDQTNNSTIDPSPSPSLAPAPMETPPPVISSSDGVPNFPKPTSPRQTPSQSETIGKWTIAQRIVSGFGLNVTHKNDNSTPSPSSSSPSAVLQSVGKGLVDTSMGAVKAVQIRARHMVSQNKRRYQEGEFDLDLTYITDNVIAMGFPAGDMSSGLFGYFEGFYRNHMEEVIKFFETHHKDRYKVYNLCSERLYDASLFAGKVASFPFNDHNCPPIHLIPSFCQSAYSWLKEDIQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G447200`
TK1151 ID	TkA06G447200
OH-1004 ID	LXL04_017388
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.000
Protein coverage (%)	TK1151 88.034 / OH-1004 88.927 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G447200

Location Chr06:110498470-110502528 (-)

Description Similar to PTEN2A: Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19420`	Binds phosphatidic acid.	A novel class of PTEN protein in Arabidopsis displays unusual phosphoinositide phosphatase activity and efficiently binds phosphatidic acid.2012 · DOI: 10.1042/bj20110776
`At3g50110`	Protein tyrosine phosphatase that also exhibits a weak lipid phosphatase activity towards PtdIns(3)P.	A novel class of PTEN protein in Arabidopsis displays unusual phosphoinositide phosphatase activity and efficiently binds phosphatidic acid.2012 · DOI: 10.1042/bj20110776

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017388 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006935 chemotaxis Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007056 spindle assembly involved in female meiosis Biological Process

GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process

GO:0007584 response to nutrient Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009651 response to salt stress Biological Process

KEGG gene cross-reference

ath:AT3G19420

ath:AT3G50110

ddi:DDB_G0286557

mmu:19211

rno:50557

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.504

Rank 1 · TkA06G447200 · TK1151

Golgi apparatus0.194

Rank 2 · TkA06G447200 · TK1151

Endoplasmic reticulum0.192

Rank 3 · TkA06G447200 · TK1151

Cell membrane0.168

Rank 4 · TkA06G447200 · TK1151

Nucleus0.160

Rank 5 · TkA06G447200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00782DSPc190-210 aa

PF22785Tc-R-P227-282 aa

PF22741PTP-NADK228-278 aa

PF22784PTP-SAK229-291 aa

PF14566PTPlike_phytase230-282 aa

PF00102Y_phosphatase245-283 aa

PF13350Y_phosphatase3254-284 aa

PF00782DSPc259-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G447200	`PF00782`	DSPc	190	210	0.00031	21.3
TkA06G447200	`PF22785`	Tc-R-P	227	282	7.5e-06	27.2
TkA06G447200	`PF22741`	PTP-NADK	228	278	0.049	13.8
TkA06G447200	`PF22784`	PTP-SAK	229	291	0.00042	21.1
TkA06G447200	`PF14566`	PTPlike_phytase	230	282	0.071	13.9
TkA06G447200	`PF00102`	Y_phosphatase	245	283	0.03	14.7
TkA06G447200	`PF13350`	Y_phosphatase3	254	284	0.00035	21.3
TkA06G447200	`PF00782`	DSPc	259	301	0.00031	21.3
TkA06G447200	`PF22918`	PTEN2_C2	334	462	1.2e-68	229.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT75`	Arabidopsis thaliana	sp\|Q9LT75\|PTN2A_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A	62.600%	Swiss-Prot	High
`Q8H106`	Arabidopsis thaliana	sp\|Q8H106\|PTN2B_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2B	58.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card