LXL04_017388 | RubberDandelionOmics

Gene overview

LXL04_017388

Reference: OH-1004 Chr: Chr03 Coordinates: 148044619-148048141 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1764 bp · LXL04_017388|LXL04_017388|OH1004|cDNA

ATGGATACAGAATCTGCTAAGGCATCCGCACCACCTCCTGTAACAGACTCAAATCCACAACCTGTTCCAGCTTCAGAATCCAAACATGATTCTACACAAGATTCACCATCAAAGCTGTCTGCTTCTGGGATAACCACATGGGCCAAAAGTCTGAAACTTCCACAGCCTTTAGGAGGCAGCAGCACCACCACACAAGATGACTCATCTCCATCTGAAAACACTGGTAGATTTGCTCGTTTGACTAGTGGACTAGGGTTACG...

CDS

Download CDS FASTA

1764 bp · LXL04_017388|LXL04_017388|OH1004|CDS

ATGGATACAGAATCTGCTAAGGCATCCGCACCACCTCCTGTAACAGACTCAAATCCACAACCTGTTCCAGCTTCAGAATCCAAACATGATTCTACACAAGATTCACCATCAAAGCTGTCTGCTTCTGGGATAACCACATGGGCCAAAAGTCTGAAACTTCCACAGCCTTTAGGAGGCAGCAGCACCACCACACAAGATGACTCATCTCCATCTGAAAACACTGGTAGATTTGCTCGTTTGACTAGTGGACTAGGGTTACG...

Protein

Download Protein FASTA

587 aa · LXL04_017388|LXL04_017388|OH1004|PROTEIN

MDTESAKASAPPPVTDSNPQPVPASESKHDSTQDSPSKLSASGITTWAKSLKLPQPLGGSSTTTQDDSSPSENTGRFARLTSGLGLRLSPKTPQQDDGQSQTPDAGQTTPQTGIFGTITKGFVDTSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVVRYFETYHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIISFCHSAYAWLKEDIENVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017388`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017388

Location Chr03:148044619-148048141 (-)

Description Similar to PTEN2A: Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19420`	Binds phosphatidic acid.	A novel class of PTEN protein in Arabidopsis displays unusual phosphoinositide phosphatase activity and efficiently binds phosphatidic acid.2012 · DOI: 10.1042/bj20110776
`At3g50110`	Protein tyrosine phosphatase that also exhibits a weak lipid phosphatase activity towards PtdIns(3)P.	A novel class of PTEN protein in Arabidopsis displays unusual phosphoinositide phosphatase activity and efficiently binds phosphatidic acid.2012 · DOI: 10.1042/bj20110776

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017388 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006935 chemotaxis Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007056 spindle assembly involved in female meiosis Biological Process

GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process

GO:0007584 response to nutrient Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009651 response to salt stress Biological Process

KEGG gene cross-reference

ath:AT3G19420

ath:AT3G50110

ddi:DDB_G0286557

mmu:19211

rno:50557

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.568

Rank 1 · LXL04_017388 · OH-1004

Cell membrane0.187

Rank 2 · LXL04_017388 · OH-1004

Endoplasmic reticulum0.186

Rank 3 · LXL04_017388 · OH-1004

Golgi apparatus0.153

Rank 4 · LXL04_017388 · OH-1004

Nucleus0.146

Rank 5 · LXL04_017388 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22785.2Tc-R-P226-280 aa

PF22918.3PTEN2_C2332-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017388	`PF22785.2`	Tc-R-P	226	280	2e-06	29.0
LXL04_017388	`PF22918.3`	PTEN2_C2	332	460	6.9e-75	249.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT75`	Arabidopsis thaliana	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A	67.002%	Swiss-Prot	strong database homology
`Q8H106`	Arabidopsis thaliana	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2B	58.541%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card