RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G437800
Reference: TK1151 Chr: Chr06 Coordinates: 108230868-108232199 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1302 bp · TkA06G437800|TK1151|cDNA

ATGGCGCCAAAATCAAGTCCACCATCGCCGCCCACTACCACCATCAACAGAAGCACTAGCGACGGCGGCACCATCATACTAAACAAGTACCAACTCACCCGCCTCTTGGGTCGTGGCAGTTTTGCAAAAGTCTACCATGGCCGCTCTCTCACCGACAATTCCTCCGTGGCCGTCAAGGTCATCGAGAAACCCGCCACCGCAGATCCCGCTATGGAGCCAAGGCTTGTCCGTGAAGTCGCAGCTATGCGGCGGCTGAACCA...

CDS

Download CDS FASTA

1302 bp · TkA06G437800|TK1151|CDS

ATGGCGCCAAAATCAAGTCCACCATCGCCGCCCACTACCACCATCAACAGAAGCACTAGCGACGGCGGCACCATCATACTAAACAAGTACCAACTCACCCGCCTCTTGGGTCGTGGCAGTTTTGCAAAAGTCTACCATGGCCGCTCTCTCACCGACAATTCCTCCGTGGCCGTCAAGGTCATCGAGAAACCCGCCACCGCAGATCCCGCTATGGAGCCAAGGCTTGTCCGTGAAGTCGCAGCTATGCGGCGGCTGAACCA...

Protein

Download Protein FASTA

433 aa · TkA06G437800|TK1151|PROTEIN

MAPKSSPPSPPTTTINRSTSDGGTIILNKYQLTRLLGRGSFAKVYHGRSLTDNSSVAVKVIEKPATADPAMEPRLVREVAAMRRLNHPNILKLHEVLATKTKIYLVMELAAGGELFTQLTRRGRMKEATARLYFQQLVSTLHFCHQNGVAHRDLKPQNLLLDKNGNLKISDFGLSALPESKKDGLLHTACGTPAFTAPEIVRGKGYDGAKADAWSCGIILFNFLSGYLPFDDSNLANMYRKIHQREILFPDWIPKQPRII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G437800
TK1151 IDTkA06G437800
OH-1004 IDLXL04_003429
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)79.400
Protein coverage (%)TK1151 94.457 / OH-1004 59.207
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G437800
LocationChr06:108230868-108232199 (+)
DescriptionSimilar to CIPK7: CBL-interacting serine/threonine-protein kinase 7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g14580 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
At3g23000 CIPK serine-threonine protein kinases interact with CBL proteins.
CIPK7 is involved in cold response by interacting with CBL1 in Arabidopsis thaliana.2011 · DOI: 10.1016/j.plantsci.2011.03.011
At5g01810 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0634400 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
Os12g0603700 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_003429 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0009409 response to cold Biological Process
GO:0009413 response to flooding Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT3G23000
ath:AT4G14580
ath:AT5G01810
dosa:Os01g0206700
dosa:Os03g0634400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.531
Rank 1 · TkA06G437800 · TK1151
Cytoplasm0.431
Rank 2 · TkA06G437800 · TK1151
Cell membrane0.136
Rank 3 · TkA06G437800 · TK1151
Endoplasmic reticulum0.053
Rank 4 · TkA06G437800 · TK1151
Lysosome / Vacuole0.029
Rank 5 · TkA06G437800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase30-284 aa
PF07714PK_Tyr_Ser-Thr31-278 aa
PF03109ABC137-63 aa
PF01163RIO143-100 aa
PF06293Kdo69-166 aa
PF01163RIO177-173 aa
PF12330Haspin_kinase98-188 aa
PF03109ABC1100-178 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G437800PF00069Pkinase302841.7e-69234.8
TkA06G437800PF07714PK_Tyr_Ser-Thr312788.5e-39134.1
TkA06G437800PF03109ABC137638e-0832.4
TkA06G437800PF01163RIO1431000.004817.3
TkA06G437800PF06293Kdo691660.0004320.5
TkA06G437800PF01163RIO1771730.004817.3
TkA06G437800PF12330Haspin_kinase981880.0004120.2
TkA06G437800PF03109ABC11001788e-0832.4
TkA06G437800PF14531Kinase-like1172331.1e-0525.6
TkA06G437800PF01636APH1221660.1113.0
TkA06G437800PF07387Seadorna_VP71401710.003517.1
TkA06G437800PF07387Seadorna_VP73053370.003517.1
TkA06G437800PF03822NAF3123692.5e-1969.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SUL7Arabidopsis thalianasp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 455.800%Swiss-ProtHigh
Q9XIW0Arabidopsis thalianasp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 754.800%Swiss-ProtHigh
P92937Arabidopsis thalianasp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 1545.800%Swiss-ProtMedium
Q75GK4Oryza sativa subsp. japonicasp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 750.100%Swiss-ProtHigh
Q2QMI0Oryza sativa subsp. japonicasp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 449.700%Swiss-ProtMedium

JBrowse

View in Genome Browser