TkA06G086710 | RubberDandelionOmics

Gene overview

TkA06G086710

Reference: TK1151 Chr: Chr06 Coordinates: 23179526-23179837 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkA06G086710|TK1151|cDNA

ATGAAAGCACTGGGATCCGACATCTCTGCCGAAGAGGTGAAGGAAGTGATGACGAAAATTGACACAGACTGCGACGGCTTCATTAACCTTGAGGAGTTCGCCGGATTCTGTAAAGAAAACGCCGGTAACCAAGACGAAGGGTTGAACGAGCTCCATGAAGCGTTCGAGCTCTACGATTTGAACAAGAACGGGTTGATCTCGTCAACGGAGCTGCATCAGATCTTGACTCGGCTGGGTGAGAGATGTACAGTTGAAGATTG...

CDS

Download CDS FASTA

312 bp · TkA06G086710|TK1151|CDS

ATGAAAGCACTGGGATCCGACATCTCTGCCGAAGAGGTGAAGGAAGTGATGACGAAAATTGACACAGACTGCGACGGCTTCATTAACCTTGAGGAGTTCGCCGGATTCTGTAAAGAAAACGCCGGTAACCAAGACGAAGGGTTGAACGAGCTCCATGAAGCGTTCGAGCTCTACGATTTGAACAAGAACGGGTTGATCTCGTCAACGGAGCTGCATCAGATCTTGACTCGGCTGGGTGAGAGATGTACAGTTGAAGATTG...

Protein

Download Protein FASTA

103 aa · TkA06G086710|TK1151|PROTEIN

MKALGSDISAEEVKEVMTKIDTDCDGFINLEEFAGFCKENAGNQDEGLNELHEAFELYDLNKNGLISSTELHQILTRLGERCTVEDCVKMISRWTPTAMVRRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G086710`
TK1151 ID	TkA06G086710
OH-1004 ID	LXL04_025028
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	75.800
Protein coverage (%)	TK1151 88.350 / OH-1004 58.710 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G086710

Location Chr06:23179526-23179837 (-)

Description Similar to Calcium-binding allergen Ole e 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18210`	Potential calcium sensor.	No verified direct reference in this release
`At1g24620`	Potential calcium sensor.	No verified direct reference in this release
`At3g03400`	Potential calcium sensor.	No verified direct reference in this release
`At1g73630`	Potential calcium sensor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025028 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010038 response to metal ion Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0045087 innate immune response Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0051592 response to calcium ion Biological Process

KEGG gene cross-reference

ath:AT1G18210

ath:AT1G66400

ath:AT1G73630

ath:AT5G37770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.614

Rank 1 · TkA06G086710 · TK1151

Nucleus0.279

Rank 2 · TkA06G086710 · TK1151

Mitochondrion0.093

Rank 3 · TkA06G086710 · TK1151

Endoplasmic reticulum0.092

Rank 4 · TkA06G086710 · TK1151

Cell membrane0.080

Rank 5 · TkA06G086710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13833EF-hand_82-38 aa

PF03484B52-24 aa

PF13499EF-hand_74-37 aa

PF21008AIF-14-33 aa

PF13405EF-hand_68-19 aa

PF13202EF-hand_58-17 aa

PF25578EF-hand_STIM18-72 aa

PF23564EF-hand_FSTL110-41 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G086710	`PF13833`	EF-hand_8	2	38	8.9e-09	35.7
TkA06G086710	`PF03484`	B5	2	24	0.076	13.9
TkA06G086710	`PF13499`	EF-hand_7	4	37	1.3e-14	55.0
TkA06G086710	`PF21008`	AIF-1	4	33	0.012	16.5
TkA06G086710	`PF13405`	EF-hand_6	8	19	5.2e-14	51.3
TkA06G086710	`PF13202`	EF-hand_5	8	17	2.7e-10	39.9
TkA06G086710	`PF25578`	EF-hand_STIM1	8	72	0.0021	18.8
TkA06G086710	`PF23564`	EF-hand_FSTL1	10	41	0.00059	20.9
TkA06G086710	`PF30624`	EF_SSP120	10	33	0.0033	18.8
TkA06G086710	`PF10208`	ARMET_C	11	35	0.17	12.1
TkA06G086710	`PF00036`	EF-hand_1	12	38	4.5e-16	57.8
TkA06G086710	`PF13405`	EF-hand_6	13	38	5.2e-14	51.3
TkA06G086710	`PF10591`	SPARC_Ca_bdg	14	34	0.057	14.4
TkA06G086710	`PF13202`	EF-hand_5	15	34	2.7e-10	39.9
TkA06G086710	`PF29176`	Allatotropin-like_C	20	33	0.0025	18.1
TkA06G086710	`PF30551`	CFAP251_C	27	92	0.029	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LE22`	Arabidopsis thaliana	sp\|Q9LE22\|CML27_ARATH Probable calcium-binding protein CML27	47.800%	Swiss-Prot	Medium
`Q9FYK2`	Arabidopsis thaliana	sp\|Q9FYK2\|CML25_ARATH Probable calcium-binding protein CML25	40.700%	Swiss-Prot	Medium
`Q9SRP4`	Arabidopsis thaliana	sp\|Q9SRP4\|CML33_ARATH Probable calcium-binding protein CML33	42.200%	Swiss-Prot	Medium
`Q9C9U8`	Arabidopsis thaliana	sp\|Q9C9U8\|CML26_ARATH Probable calcium-binding protein CML26	69.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card