LXL04_025028 | RubberDandelionOmics

Gene overview

LXL04_025028

Reference: OH-1004 Chr: Chr05 Coordinates: 104299811-104300278 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · LXL04_025028|LXL04_025028|OH1004|cDNA

ATGGCGACGGCAACCAACAACCTGTCACTCTACATGACCAACATCGACGACGTGAAGAAAATCTTCACCCGTTTCGACACCAATGGCGACGGCCAGATCTCTTCGGAGGAGCTCGTCCACGTCATGAAAGCACTGGGATCCGACATCTCTGCCGAAGAGGTGAAGGAAGTGATGACGAAAATTGACACAGACTGCGACGGCTTCATTAACCTTGAGGAGTTCGCCGGATTCTGTAAAGAAAACGCCGGTAACCAAGACGA...

CDS

Download CDS FASTA

468 bp · LXL04_025028|LXL04_025028|OH1004|CDS

ATGGCGACGGCAACCAACAACCTGTCACTCTACATGACCAACATCGACGACGTGAAGAAAATCTTCACCCGTTTCGACACCAATGGCGACGGCCAGATCTCTTCGGAGGAGCTCGTCCACGTCATGAAAGCACTGGGATCCGACATCTCTGCCGAAGAGGTGAAGGAAGTGATGACGAAAATTGACACAGACTGCGACGGCTTCATTAACCTTGAGGAGTTCGCCGGATTCTGTAAAGAAAACGCCGGTAACCAAGACGA...

Protein

Download Protein FASTA

155 aa · LXL04_025028|LXL04_025028|OH1004|PROTEIN

MATATNNLSLYMTNIDDVKKIFTRFDTNGDGQISSEELVHVMKALGSDISAEEVKEVMTKIDTDCDGFINLEEFAGFCKENAGNQDEGLNELQEAFELYDLNKNGLISSTELHQILTRLGERCTVEDCVKMIKSVDSDGDGYVDFEEFKKMMSRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025028`
TK1151 ID	TkA06G086710
OH-1004 ID	LXL04_025028
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	75.800
Protein coverage (%)	TK1151 88.350 / OH-1004 58.710 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025028

Location Chr05:104299811-104300278 (+)

Description Similar to Calcium-binding allergen Ole e 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73630`	Potential calcium sensor.	No verified direct reference in this release
`At1g18210`	Potential calcium sensor.	No verified direct reference in this release
`At1g66400`	Potential calcium sensor.	No verified direct reference in this release
`At5g37770`	Calcium-binding protein that may positively regulate abscisic acid (ABA) inhibition of germination and seedling development.	CML24, regulated in expression by diverse stimuli, encodes a potential Ca2+ sensor that functions in responses to abscisic acid, daylength, and ion stress.2005 · DOI: 10.1104/pp.105.062612

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025028 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010038 response to metal ion Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0045087 innate immune response Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0051592 response to calcium ion Biological Process

KEGG gene cross-reference

ath:AT1G18210

ath:AT1G66400

ath:AT1G73630

ath:AT5G37770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.650

Rank 1 · LXL04_025028 · OH-1004

Nucleus0.270

Rank 2 · LXL04_025028 · OH-1004

Endoplasmic reticulum0.086

Rank 3 · LXL04_025028 · OH-1004

Cell membrane0.073

Rank 4 · LXL04_025028 · OH-1004

Peroxisome0.067

Rank 5 · LXL04_025028 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13833.13EF-hand_86-43 aa

PF00036.39EF-hand_117-45 aa

PF13499.13EF-hand_717-78 aa

PF13405.13EF-hand_618-46 aa

PF13202.13EF-hand_519-42 aa

PF13833.13EF-hand_830-78 aa

PF00036.39EF-hand_153-79 aa

PF21008.4AIF-184-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025028	`PF13833.13`	EF-hand_8	6	43	1e-24	86.7
LXL04_025028	`PF00036.39`	EF-hand_1	17	45	3.6e-36	120.7
LXL04_025028	`PF13499.13`	EF-hand_7	17	78	3.1e-32	111.4
LXL04_025028	`PF13405.13`	EF-hand_6	18	46	1.4e-29	99.6
LXL04_025028	`PF13202.13`	EF-hand_5	19	42	2.8e-25	87.3
LXL04_025028	`PF13833.13`	EF-hand_8	30	78	1e-24	86.7
LXL04_025028	`PF00036.39`	EF-hand_1	53	79	3.6e-36	120.7
LXL04_025028	`PF21008.4`	AIF-1	84	152	3.8e-10	40.9
LXL04_025028	`PF13499.13`	EF-hand_7	90	153	3.1e-32	111.4
LXL04_025028	`PF00036.39`	EF-hand_1	91	119	3.6e-36	120.7
LXL04_025028	`PF13405.13`	EF-hand_6	91	120	1.4e-29	99.6
LXL04_025028	`PF13202.13`	EF-hand_5	92	115	2.8e-25	87.3
LXL04_025028	`PF13833.13`	EF-hand_8	104	154	1e-24	86.7
LXL04_025028	`PF00036.39`	EF-hand_1	128	154	3.6e-36	120.7
LXL04_025028	`PF13202.13`	EF-hand_5	132	152	2.8e-25	87.3
LXL04_025028	`PF13405.13`	EF-hand_6	133	153	1.4e-29	99.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9U8`	Arabidopsis thaliana	Probable calcium-binding protein CML26	56.204%	Swiss-Prot	strong database homology
`Q9LE22`	Arabidopsis thaliana	Probable calcium-binding protein CML27	51.408%	Swiss-Prot	strong database homology
`Q9C8Y1`	Arabidopsis thaliana	Probable calcium-binding protein CML23	50.704%	Swiss-Prot	strong database homology
`P25070`	Arabidopsis thaliana	Calcium-binding protein CML24	48.077%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card