TkA06G059030 | RubberDandelionOmics

Gene overview

TkA06G059030

Reference: TK1151 Chr: Chr06 Coordinates: 15943855-15945268 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

975 bp · TkA06G059030|TK1151|cDNA

ATGGATGTTTCCGGTCAACTTAAGCAAGTAACATGGTTGGAAACGGAAACTACCAAAGGGTGGAATACACTTTGGTCTCAGCCTAGAATGCAGTGTGAGAGTGATTTCTCCGGTGGGTGTGTGAGAAAAACCGATTTGGAGTGTGGGAGAAACAGGTGCTTGGTTTGGGATGGAGATCTCTGGGATCTTTGGGAAGTGGATGATGGTGAGCAAACCATCCTTGTGAAAGTTGCGTCTAGAGATCTTCCACGTCATAAAAA...

CDS

Download CDS FASTA

975 bp · TkA06G059030|TK1151|CDS

ATGGATGTTTCCGGTCAACTTAAGCAAGTAACATGGTTGGAAACGGAAACTACCAAAGGGTGGAATACACTTTGGTCTCAGCCTAGAATGCAGTGTGAGAGTGATTTCTCCGGTGGGTGTGTGAGAAAAACCGATTTGGAGTGTGGGAGAAACAGGTGCTTGGTTTGGGATGGAGATCTCTGGGATCTTTGGGAAGTGGATGATGGTGAGCAAACCATCCTTGTGAAAGTTGCGTCTAGAGATCTTCCACGTCATAAAAA...

Protein

Download Protein FASTA

324 aa · TkA06G059030|TK1151|PROTEIN

MDVSGQLKQVTWLETETTKGWNTLWSQPRMQCESDFSGGCVRKTDLECGRNRCLVWDGDLWDLWEVDDGEQTILVKVASRDLPRHKKNNWAIIGCGVAGVENKDIHCKDNNGGIVGGGVLCDTSIVAVKNLESISQGEKQFRSEVSTIGTIQHVNLVRLRGFCAQVLNWETRYQIALGTARGLVYLHDKCRECIIHCDIKPENILLDVDFSPKIADFGLAKLIGRDFSRTLTTTRGSIGYLAPEWLSGVAITAKADVYSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G059030`
TK1151 ID	TkA06G059030
OH-1004 ID	LXL04_025439
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.600
Protein coverage (%)	TK1151 100.000 / OH-1004 40.353 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G059030

Location Chr06:15943855-15945268 (-)

Description Similar to At2g19130: G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19130`	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130.	No verified direct reference in this release
`At4g00340`	Serine/threonine-protein kinase.	No verified direct reference in this release
`At4g32300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5.	No verified direct reference in this release
`At1g34300`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300.	No verified direct reference in this release
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025439 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G65800

ath:AT2G19130

ath:AT4G00340

ath:AT4G21380

ath:AT5G24080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.376

Rank 1 · TkA06G059030 · TK1151

Cytoplasm0.366

Rank 2 · TkA06G059030 · TK1151

Nucleus0.284

Rank 3 · TkA06G059030 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA06G059030 · TK1151

Golgi apparatus0.048

Rank 5 · TkA06G059030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00954S_locus_glycop1-34 aa

PF00069Pkinase123-165 aa

PF07714PK_Tyr_Ser-Thr123-165 aa

PF07714PK_Tyr_Ser-Thr167-277 aa

PF00069Pkinase173-273 aa

PF03109ABC1185-232 aa

PF05445Pox_ser-thr_kin187-206 aa

PF01636APH189-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G059030	`PF00954`	S_locus_glycop	1	34	0.015	16.5
TkA06G059030	`PF00069`	Pkinase	123	165	1.8e-28	100.4
TkA06G059030	`PF07714`	PK_Tyr_Ser-Thr	123	165	4.1e-23	82.7
TkA06G059030	`PF07714`	PK_Tyr_Ser-Thr	167	277	4.1e-23	82.7
TkA06G059030	`PF00069`	Pkinase	173	273	1.8e-28	100.4
TkA06G059030	`PF03109`	ABC1	185	232	0.026	14.4
TkA06G059030	`PF05445`	Pox_ser-thr_kin	187	206	0.37	10.4
TkA06G059030	`PF01636`	APH	189	221	0.05	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64477`	Arabidopsis thaliana	sp\|O64477\|Y2913_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130	61.200%	Swiss-Prot	Medium
`Q39203`	Arabidopsis thaliana	sp\|Q39203\|SD22_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2	49.600%	Swiss-Prot	Medium
`Q8RWZ5`	Arabidopsis thaliana	sp\|Q8RWZ5\|SD25_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5	46.800%	Swiss-Prot	Medium
`Q9XID3`	Arabidopsis thaliana	sp\|Q9XID3\|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300	46.900%	Swiss-Prot	Medium
`Q9FLV4`	Arabidopsis thaliana	sp\|Q9FLV4\|Y5248_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card