LXL04_025439 | RubberDandelionOmics

Gene overview

LXL04_025439

Reference: OH-1004 Chr: Chr05 Coordinates: 111730136-111734430 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3066 bp · LXL04_025439|LXL04_025439|OH1004|cDNA

ATGGAGAGAGGAATGATATCAGTGGATCGGTGGGCTGAAGGCAGTCAGCTGTATTTCTTAACTCATCTTCACGCCGATCATACAGCAGGCTTGTCGACTCGTTGGAAGAGAGGTCCACTATTTTGCTCTCGCATCACTGCTAAGCTTTTCTCTCCTAAATTCCCTGGTTTCGACCTCACATTGCTTCGAGTTCTCGAAATTGGACAATGGTGCTCGTTATCTTTGGTTTCCCCGTCGTCTGGCTTGGAAACTAAGGTTGA...

CDS

Download CDS FASTA

3066 bp · LXL04_025439|LXL04_025439|OH1004|CDS

ATGGAGAGAGGAATGATATCAGTGGATCGGTGGGCTGAAGGCAGTCAGCTGTATTTCTTAACTCATCTTCACGCCGATCATACAGCAGGCTTGTCGACTCGTTGGAAGAGAGGTCCACTATTTTGCTCTCGCATCACTGCTAAGCTTTTCTCTCCTAAATTCCCTGGTTTCGACCTCACATTGCTTCGAGTTCTCGAAATTGGACAATGGTGCTCGTTATCTTTGGTTTCCCCGTCGTCTGGCTTGGAAACTAAGGTTGA...

Protein

Download Protein FASTA

1021 aa · LXL04_025439|LXL04_025439|OH1004|PROTEIN

MERGMISVDRWAEGSQLYFLTHLHADHTAGLSTRWKRGPLFCSRITAKLFSPKFPGFDLTLLRVLEIGQWCSLSLVSPSSGLETKVEVIAIDANHCPGAVMYLFRGDFGSMLYTGDFRWEVGTEISEMGKNMLLTALNNHKVDTLYIDNTYCDPSYSFPSRAVAAQQILNIINSYPDHDIIIGIDSLGKEDLLLYISKTLKVKIWVWPERLQTMHLLGLHDNFTTKTTLTRIRAVPRYSFSVETLEGLNTMRPTIGIMPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025439`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025439

Location Chr05:111730136-111734430 (+)

Description Similar to At2g19130: G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19130`	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130.	No verified direct reference in this release
`At4g00340`	Serine/threonine-protein kinase.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release
`At1g65800`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025439 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G65800

ath:AT2G19130

ath:AT4G00340

ath:AT4G21380

ath:AT5G24080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.673

Rank 1 · LXL04_025439 · OH-1004

Endoplasmic reticulum0.117

Rank 2 · LXL04_025439 · OH-1004

Cytoplasm0.106

Rank 3 · LXL04_025439 · OH-1004

Nucleus0.087

Rank 4 · LXL04_025439 · OH-1004

Lysosome / Vacuole0.060

Rank 5 · LXL04_025439 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07522.20DRMBL220-331 aa

PF01453.31B_lectin408-510 aa

PF00954.26S_locus_glycop530-617 aa

PF08276.18PAN_2625-666 aa

PF00069.32Pkinase747-808 aa

PF07714.24PK_Tyr_Ser-Thr747-808 aa

PF07714.24PK_Tyr_Ser-Thr810-986 aa

PF00069.32Pkinase816-983 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025439	`PF07522.20`	DRMBL	220	331	1.3e-09	38.9
LXL04_025439	`PF01453.31`	B_lectin	408	510	3.4e-30	105.3
LXL04_025439	`PF00954.26`	S_locus_glycop	530	617	9.7e-23	81.5
LXL04_025439	`PF08276.18`	PAN_2	625	666	6.6e-08	33.3
LXL04_025439	`PF00069.32`	Pkinase	747	808	1.5e-35	123.6
LXL04_025439	`PF07714.24`	PK_Tyr_Ser-Thr	747	808	5.5e-31	108.5
LXL04_025439	`PF07714.24`	PK_Tyr_Ser-Thr	810	986	5.5e-31	108.5
LXL04_025439	`PF00069.32`	Pkinase	816	983	1.5e-35	123.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64477`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130	47.507%	Swiss-Prot	moderate database homology
`Q39203`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2	36.130%	Swiss-Prot	moderate database homology
`O81905`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-8	30.214%	Swiss-Prot	moderate database homology
`Q9FLV4`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	30.388%	Swiss-Prot	moderate database homology
`Q9S972`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-6	30.395%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card