TkA05G388560 | RubberDandelionOmics

Gene overview

TkA05G388560

Reference: TK1151 Chr: Chr05 Coordinates: 96559112-96560271 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

959 bp · TkA05G388560|TK1151|cDNA

CCCACAAGGCCTTTCCAATTTCGAAAACTCACATCACGAAAAAATACAGTACAAATCAAGTGCAATCAAGGGGACACACCCAAAACGATTTTGGAAATACACTTCATCAAATCGGTTAGAACAAATACAGTAGGAATTAGCAGACATGTAGGAATTAGCAGACATGTATGAAGCAAATAATCGAATTGACACAGGGCCTTATTCATGATCGGAGATTGAAGAATGAAGACGAGCGACTTACCCGACGATCGGATTTTCCG...

CDS

Download CDS FASTA

486 bp · TkA05G388560|TK1151|CDS

ATGGGCATTGAGTGGCAAAATCTCAAAGGGCTCATGGTGTTGGATCTTTCAAGCACACAATTGATGGGTGGCATTCCCAAGTCCATTTCCGAGATGAAAAAGCTAAGATTTTTAGGTCTTAATGACAATTATCTTTCCGGAAATCTTACACCAAAGTTGGCAGAATTATGTGATCTAAGTTCGCTATATGTATATGGAAACAACCTCTCCGGAAAGCTGGAATTTGATGGAGGGTTTTATGGAAAAATGAGTAGACGATT...

Protein

Download Protein FASTA

161 aa · TkA05G388560|TK1151|PROTEIN

MGIEWQNLKGLMVLDLSSTQLMGGIPKSISEMKKLRFLGLNDNYLSGNLTPKLAELCDLSSLYVYGNNLSGKLEFDGGFYGKMSRRFGAWNNLNLCVPVDLLPTDLRPFGIKTCREELEVSSFHESDSKLHNFVTSFGFTRYKLDGMWGLFSVVVSFNMVM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G388560`
TK1151 ID	TkA05G388560
OH-1004 ID	LXL04_021412
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.800
Protein coverage (%)	TK1151 55.901 / OH-1004 19.313 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G388560`
Location	Chr05:96559112-96560271 (+)
Description	Similar to PII-2: Piriformospora indica-insensitive protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021412` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007165 signal transduction Biological Process GO:0008356 asymmetric cell division Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009611 response to wounding Biological Process GO:0009620 response to fungus Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010090 trichome morphogenesis Biological Process GO:0010375 stomatal complex patterning Biological Process GO:0010376 stomatal complex formation Biological Process GO:0042659 regulation of cell fate specification Biological Process GO:0044403 biological process involved in symbiotic interaction Biological Process GO:0045087 innate immune response Biological Process
KEGG gene cross-reference	ath:AT1G13230 ath:AT1G80080 ath:AT2G42800 ath:AT4G20140 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.695

Rank 1 · TkA05G388560 · TK1151

Endoplasmic reticulum0.136

Rank 2 · TkA05G388560 · TK1151

Cytoplasm0.083

Rank 3 · TkA05G388560 · TK1151

Nucleus0.069

Rank 4 · TkA05G388560 · TK1151

Extracellular0.059

Rank 5 · TkA05G388560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855LRR_86-45 aa

PF23598LRR_146-65 aa

PF00560LRR_111-31 aa

PF12799LRR_413-47 aa

PF12799LRR_433-74 aa

PF00560LRR_134-54 aa

PF13855LRR_858-69 aa

PF00560LRR_159-73 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G388560	`PF13855`	LRR_8	6	45	2.4e-05	24.7
TkA05G388560	`PF23598`	LRR_14	6	65	0.0014	18.1
TkA05G388560	`PF00560`	LRR_1	11	31	1.5e-05	24.9
TkA05G388560	`PF12799`	LRR_4	13	47	0.00021	22.2
TkA05G388560	`PF12799`	LRR_4	33	74	0.00021	22.2
TkA05G388560	`PF00560`	LRR_1	34	54	1.5e-05	24.9
TkA05G388560	`PF13855`	LRR_8	58	69	2.4e-05	24.7
TkA05G388560	`PF00560`	LRR_1	59	73	1.5e-05	24.9
TkA05G388560	`PF00560`	LRR_1	91	95	1.5e-05	24.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card