TkA05G248950 | RubberDandelionOmics

Gene overview

TkA05G248950

Reference: TK1151 Chr: Chr05 Coordinates: 61919868-61922647 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1898 bp · TkA05G248950|TK1151|cDNA

CTCACGAGTTTAACCTTTGTTGTCCTATAAATCTATGCCTCAGTTCCTCCAAGATACTAAATATCAGCGATGGGTAAAAACGCACAGGATTTGACTAAAGACTATGAGGAAGAAATCATTTTCCGAAGTCGTTACCCGCCTGTCCCCATTCCCGACCTCTTATTGCCGGATTTCGTGCTCAAGGATGCTGAATCTTACGCCGACAATGTTGCATTCATCGATGCTGCCACAAAGAAATCCTACACGTATGGCGATGTAGT...

CDS

Download CDS FASTA

1650 bp · TkA05G248950|TK1151|CDS

ATGGGTAAAAACGCACAGGATTTGACTAAAGACTATGAGGAAGAAATCATTTTCCGAAGTCGTTACCCGCCTGTCCCCATTCCCGACCTCTTATTGCCGGATTTCGTGCTCAAGGATGCTGAATCTTACGCCGACAATGTTGCATTCATCGATGCTGCCACAAAGAAATCCTACACGTATGGCGATGTAGTTAGGGACGTTAGAAGGTCTTCTAAGGCTTTGAGGTCACTTGGCATGCGAACTGGGCATGTTATCGTTGT...

Protein

Download Protein FASTA

549 aa · TkA05G248950|TK1151|PROTEIN

MGKNAQDLTKDYEEEIIFRSRYPPVPIPDLLLPDFVLKDAESYADNVAFIDAATKKSYTYGDVVRDVRRSSKALRSLGMRTGHVIVVVLPNIVEYGIVALGIMGGGGVFSGANPSSHSSEIKKQVELAGATLIITDDKTYNKVSKLGLPVVIVGKERVQGTILWEELLEAGERVSNSVVENIVTQDDLCALPFSSGTTGLSKGVMLTHRNIVANLCSTLFSVGPDLIGKVTILGLIPYFHIYGLTGILCATLKNKGKVVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G248950`
TK1151 ID	TkA05G248950
OH-1004 ID	LXL04_020604
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G248950

Location Chr05:61919868-61922647 (+)

Description Similar to 4CLL1: 4-coumarate--CoA ligase-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62940`	Carboxylate--CoA ligase that may use 4-coumarate as substrate.	No verified direct reference in this release
`At3g21240`	Produces CoA thioesters of a variety of hydroxy- and methoxy-substituted cinnamic acids, which are used to synthesize several phenylpropanoid-derived compounds, including anthocyanins, flavonoids, isoflavonoids, coumarins, lignin, suberin and wall-bound phenolics.	Three 4-coumarate:coenzyme A ligases in Arabidopsis thaliana represent two evolutionarily divergent classes in angiosperms.1999 · DOI: 10.1046/j.1365-313x.1999.00491.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0310700`	Carboxylate--CoA ligase that may use 4-coumarate as substrate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020604 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0009411 response to UV Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0009800 cinnamic acid biosynthetic process Biological Process

GO:0009803 cinnamic acid metabolic process Biological Process

GO:0033494 ferulate metabolic process Biological Process

GO:0046949 fatty-acyl-CoA biosynthetic process Biological Process

GO:0052315 phytoalexin biosynthetic process Biological Process

GO:0080110 sporopollenin biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G62940

ath:AT3G21240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.333

Rank 1 · TkA05G248950 · TK1151

Cytoplasm0.256

Rank 2 · TkA05G248950 · TK1151

Endoplasmic reticulum0.189

Rank 3 · TkA05G248950 · TK1151

Mitochondrion0.124

Rank 4 · TkA05G248950 · TK1151

Nucleus0.073

Rank 5 · TkA05G248950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501AMP-binding39-403 aa

PF12606RELT233-256 aa

PF01043SecA_PP_bind357-383 aa

PF01043SecA_PP_bind420-439 aa

PF13193AMP-binding_C454-529 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G248950	`PF00501`	AMP-binding	39	403	2e-79	267.9
TkA05G248950	`PF12606`	RELT	233	256	0.016	15.0
TkA05G248950	`PF01043`	SecA_PP_bind	357	383	0.17	13.2
TkA05G248950	`PF01043`	SecA_PP_bind	420	439	0.17	13.2
TkA05G248950	`PF13193`	AMP-binding_C	454	529	7.1e-17	62.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQ12`	Arabidopsis thaliana	sp\|Q9LQ12\|4CLL1_ARATH 4-coumarate--CoA ligase-like 1	68.000%	Swiss-Prot	High
`Q9S725`	Arabidopsis thaliana	sp\|Q9S725\|4CL2_ARATH 4-coumarate--CoA ligase 2	38.400%	Swiss-Prot	Medium
`Q7XXL2`	Oryza sativa subsp. japonica	sp\|Q7XXL2\|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9	59.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card