TkA05G060810 | RubberDandelionOmics

Gene overview

TkA05G060810

Reference: TK1151 Chr: Chr05 Coordinates: 16136987-16145397 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

783 bp · TkA05G060810|TK1151|cDNA

ATGGGAATGCATACACCCATTAAAAGAAGTGAACAGCCTTTGGAAACCAAAGGCGTGATTAGACTTTGTGCTAAAAGGCGTGAACAACCTTTAAAAGCTAAAAGCGTGAATAGCTTTGAAGGAAAAAGGCGTGATTGGCCTTTCAAGCTAAAGGGCGTGAACAGGCTTTGCCCTAAGGGGCGTGAACAGGTAGTGAGACCCCTTAAAGGGCGTGAACAGGCAGGTTATTCTTCTCCAACTCAATCTGCCATCAGGGAGTA...

CDS

Download CDS FASTA

783 bp · TkA05G060810|TK1151|CDS

ATGGGAATGCATACACCCATTAAAAGAAGTGAACAGCCTTTGGAAACCAAAGGCGTGATTAGACTTTGTGCTAAAAGGCGTGAACAACCTTTAAAAGCTAAAAGCGTGAATAGCTTTGAAGGAAAAAGGCGTGATTGGCCTTTCAAGCTAAAGGGCGTGAACAGGCTTTGCCCTAAGGGGCGTGAACAGGTAGTGAGACCCCTTAAAGGGCGTGAACAGGCAGGTTATTCTTCTCCAACTCAATCTGCCATCAGGGAGTA...

Protein

Download Protein FASTA

260 aa · TkA05G060810|TK1151|PROTEIN

MGMHTPIKRSEQPLETKGVIRLCAKRREQPLKAKSVNSFEGKRRDWPFKLKGVNRLCPKGREQVVRPLKGREQAGYSSPTQSAIREYLNLSLAEYSLFGSILTFGAMICAISSGPMADFFGRKGDTQEAHAGQNSSSIWFRLCIRGTFIDGSVKYTMTSMNVPEPVVSLVVSPVSKDSRKQFSKALNQFQREDPTFRVGLDPESGQVFEELNLIMRIIFVTGAGDETLRFWNVFPSPKCQVMQNTESEIVASSFGRMHIR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G060810`
TK1151 ID	TkA05G060810
OH-1004 ID	LXL04_019535
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G060810

Location Chr05:16136987-16145397 (+)

Description Similar to MEFG2: Elongation factor G-2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g45332`	Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation.	No verified direct reference in this release
`At2g45030`	Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0565500`	Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019535 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0070125 mitochondrial translational elongation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003746 translation elongation factor activity Molecular Function

GO:0003924 GTPase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ago:AGOS_ABR227C

ath:AT1G45332

ath:AT2G45030

dosa:Os03g0565500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.335

Rank 1 · TkA05G060810 · TK1151

Nucleus0.259

Rank 2 · TkA05G060810 · TK1151

Mitochondrion0.185

Rank 3 · TkA05G060810 · TK1151

Cell membrane0.171

Rank 4 · TkA05G060810 · TK1151

Endoplasmic reticulum0.116

Rank 5 · TkA05G060810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_178-123 aa

PF00083Sugar_tr91-123 aa

PF14492EFG_III162-207 aa

PF14492EFG_III243-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G060810	`PF07690`	MFS_1	78	123	0.0051	16.5
TkA05G060810	`PF00083`	Sugar_tr	91	123	0.05	13.2
TkA05G060810	`PF14492`	EFG_III	162	207	4.1e-12	46.7
TkA05G060810	`PF14492`	EFG_III	243	259	4.1e-12	46.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C641`	Arabidopsis thaliana	sp\|Q9C641\|EFGM1_ARATH Elongation factor G-1, mitochondrial	73.200%	Swiss-Prot	Low
`F4IW10`	Arabidopsis thaliana	sp\|F4IW10\|EFGM2_ARATH Elongation factor G-2, mitochondrial	73.200%	Swiss-Prot	Low
`Q9FE64`	Oryza sativa subsp. japonica	sp\|Q9FE64\|EFGM_ORYSJ Elongation factor G, mitochondrial	72.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card