LXL04_019535 | RubberDandelionOmics

Gene overview

LXL04_019535

Reference: OH-1004 Chr: Chr04 Coordinates: 33163781-33172173 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · LXL04_019535|LXL04_019535|OH1004|cDNA

ATGGGAATGCATACACCCATTAAAAGGAGTGAACAGCCTTTGGAAACCAAAGGCGTGATTAGACTTTGTGctaaaaggcgtgaacagcctttaAAAGCTAAAAGCGTGAATAGCTTTGAAGGAaaaaggcgtgattggcctTTCAAGCTAAAGGGCGTGAACAGGCTTTGCCCTAAGGGGCGTGAACAGGTAGTGAGACCCCTTAAAGGGCGTGAACAGGCAGGTTATTCTTCTCCAACTCAATCTGCCATCAGGGAGTA...

CDS

Download CDS FASTA

816 bp · LXL04_019535|LXL04_019535|OH1004|CDS

ATGGGAATGCATACACCCATTAAAAGGAGTGAACAGCCTTTGGAAACCAAAGGCGTGATTAGACTTTGTGCTAAAAGGCGTGAACAGCCTTTAAAAGCTAAAAGCGTGAATAGCTTTGAAGGAAAAAGGCGTGATTGGCCTTTCAAGCTAAAGGGCGTGAACAGGCTTTGCCCTAAGGGGCGTGAACAGGTAGTGAGACCCCTTAAAGGGCGTGAACAGGCAGGTTATTCTTCTCCAACTCAATCTGCCATCAGGGAGTA...

Protein

Download Protein FASTA

271 aa · LXL04_019535|LXL04_019535|OH1004|PROTEIN

MGMHTPIKRSEQPLETKGVIRLCAKRREQPLKAKSVNSFEGKRRDWPFKLKGVNRLCPKGREQVVRPLKGREQAGYSSPTQSAIREYLNLSLAEYSLFGSILTFGAMICAISSGPMADFFGRKGILWSFLEMTKQDIQEAHAGQNSSSIWFRLCIRGTFIDGSVKYTMTSMNVPEPVVSLAVSPVSKDSRKQFSKALNQFQREDPTFRVGLDPESGQVFEELNLIMRIIFVTGAGDETLRFWNVFPSPKCQVMQNTESEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019535`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019535

Location Chr04:33163781-33172173 (+)

Description Similar to MEFG2: Elongation factor G-2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45030`	Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation.	No verified direct reference in this release
`At1g45332`	Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0565500`	Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019535 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0070125 mitochondrial translational elongation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003746 translation elongation factor activity Molecular Function

GO:0003924 GTPase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ago:AGOS_ABR227C

ath:AT1G45332

ath:AT2G45030

dosa:Os03g0565500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.338

Rank 1 · LXL04_019535 · OH-1004

Nucleus0.257

Rank 2 · LXL04_019535 · OH-1004

Mitochondrion0.187

Rank 3 · LXL04_019535 · OH-1004

Cell membrane0.166

Rank 4 · LXL04_019535 · OH-1004

Endoplasmic reticulum0.120

Rank 5 · LXL04_019535 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14492.13EFG_III173-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019535	`PF14492.13`	EFG_III	173	218	4.9e-13	49.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IW10`	Arabidopsis thaliana	Elongation factor G-2, mitochondrial	72.941%	Swiss-Prot	weak database homology
`Q9C641`	Arabidopsis thaliana	Elongation factor G-1, mitochondrial	72.941%	Swiss-Prot	weak database homology
`Q9FE64`	Oryza sativa subsp. japonica	Elongation factor G, mitochondrial	71.765%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card