TkA05G025850 | RubberDandelionOmics

Gene overview

TkA05G025850

Reference: TK1151 Chr: Chr05 Coordinates: 7031082-7035362 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1512 bp · TkA05G025850|TK1151|cDNA

ATGCATCCAGAAGTCCTTCAATCATATTTTCAAGAAGACCTTGATCAATCTCAAATCTATGGTCTAAAATACGCATGTGAAGACCATGACTTCTACTCCTCAATCACAACCCCTGAGGACTCCTCCGTGATCACCTCAGACTCACACTTTCATGCCATATCACCATGTAATTTTGGTGTGTTACCTGATTTAGCTGATGAGATGCAAGTAGTATTTCCTATCGAGAATATTGCGCAACATATGGAAGGGATTGAAGGAAT...

CDS

Download CDS FASTA

1512 bp · TkA05G025850|TK1151|CDS

ATGCATCCAGAAGTCCTTCAATCATATTTTCAAGAAGACCTTGATCAATCTCAAATCTATGGTCTAAAATACGCATGTGAAGACCATGACTTCTACTCCTCAATCACAACCCCTGAGGACTCCTCCGTGATCACCTCAGACTCACACTTTCATGCCATATCACCATGTAATTTTGGTGTGTTACCTGATTTAGCTGATGAGATGCAAGTAGTATTTCCTATCGAGAATATTGCGCAACATATGGAAGGGATTGAAGGAAT...

Protein

Download Protein FASTA

503 aa · TkA05G025850|TK1151|PROTEIN

MHPEVLQSYFQEDLDQSQIYGLKYACEDHDFYSSITTPEDSSVITSDSHFHAISPCNFGVLPDLADEMQVVFPIENIAQHMEGIEGISGTELEDVLRWWGESEEMDYNSQEISMVNEGVCSSPFMKSSDDIKMVLPLDDDMEVEGEKSLYHLLNAYGEAMEMGQRDLANVITECINEKASPLGGTMERVAFNLFHSGTQCDYIKHESMKNFKSAFEAFYEIFPYGRFSHFAANSAILEAIMSSDSQKVHIIDFDIGEGVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G025850`
TK1151 ID	TkA05G025850
OH-1004 ID	LXL04_019174
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.500
Protein coverage (%)	TK1151 100.000 / OH-1004 46.941 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G025850

Location Chr05:7031082-7035362 (+)

Description Similar to NSP2: Protein NODULATION SIGNALING PATHWAY 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66770`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At4g08250`	Probable transcription factor involved in plant development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0127800`	Probable transcription factor that acts as a positive regulator of brassinosteroid (BR) signaling.	SMALL ORGAN SIZE 1 and SMALL ORGAN SIZE 2/DWARF AND LOW-TILLERING Form a Complex to Integrate Auxin and Brassinosteroid Signaling in Rice.2017 · DOI: 10.1016/j.molp.2016.12.013

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019174 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009877 nodulation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G66770

mtr:11406790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.839

Rank 1 · TkA05G025850 · TK1151

Cytoplasm0.241

Rank 2 · TkA05G025850 · TK1151

Cell membrane0.041

Rank 3 · TkA05G025850 · TK1151

Endoplasmic reticulum0.031

Rank 4 · TkA05G025850 · TK1151

Plastid0.025

Rank 5 · TkA05G025850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21616Topo-V_HhH_2_2nd59-101 aa

PF03514GRAS150-503 aa

PF11568Med29189-221 aa

PF20362DUF6657362-418 aa

PF11568Med29377-407 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G025850	`PF21616`	Topo-V_HhH_2_2nd	59	101	0.26	12.0
TkA05G025850	`PF03514`	GRAS	150	503	4e-46	158.4
TkA05G025850	`PF11568`	Med29	189	221	0.073	14.0
TkA05G025850	`PF20362`	DUF6657	362	418	0.026	15.0
TkA05G025850	`PF11568`	Med29	377	407	0.073	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL03`	Arabidopsis thaliana	sp\|Q9FL03\|SCL4_ARATH Scarecrow-like protein 4	29.200%	Swiss-Prot	Low
`Q9SUF5`	Arabidopsis thaliana	sp\|Q9SUF5\|SCL26_ARATH Scarecrow-like protein 26	25.600%	Swiss-Prot	Low
`Q9LWU9`	Oryza sativa subsp. japonica	sp\|Q9LWU9\|DLT_ORYSJ Protein DWARF AND LOW-TILLERING	23.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card