TkA05G020460 | RubberDandelionOmics

Gene overview

TkA05G020460

Reference: TK1151 Chr: Chr05 Coordinates: 5597458-5602021 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3200 bp · TkA05G020460|TK1151|cDNA

ATAAGATGTATGATTTCCTTCATTAGCTTCTCGTTCTCTTACCAAACTCAAAGGGTGCGATTAAATCCGCTAATGGAGGGTCTTCTGTAACTCCAATTGAGGTCTTATAGACACTGCTGCTGTCGTCGTCCCTCACGGATCATCGCTACTACTTGCGAAAATCTCTGTTACAAAGAAGATTCCCTAGGGTTTATTCATATGTACATCTGATCCACCATTCTTCTGCGCTTTCTCTCATTTCTCATACTTCATCTTGTAGT...

CDS

Download CDS FASTA

2592 bp · TkA05G020460|TK1151|CDS

ATGAAAATTAGGGTTTTATATCTTTTACTTGTATTCTCTATATCATTGGGTCTCATCCATGGAGAAGAAGAGAAGGCGAACAAGTTTCGTGACCGCGAGGCCACGGACGATAGCTTGGGCTATCCCAATTTCGATGAGGATGAACTGTTGAATAAACAATGCCCTCAGAATTTGGAGCTAAGATGGCAGACTGAAGTTAGTTCTAGCATATATGCAACACCATTGATTGCTGACATTAACAGTGATGGCAAGCTTGATGT...

Protein

Download Protein FASTA

863 aa · TkA05G020460|TK1151|PROTEIN

MKIRVLYLLLVFSISLGLIHGEEEKANKFRDREATDDSLGYPNFDEDELLNKQCPQNLELRWQTEVSSSIYATPLIADINSDGKLDVVVPSFVHYLEVLEGSDGDKMPGWPAFHQSTVHASPLLYDIDKDGVREIALATYNGEVLFFRSSGYMMSDKLEVPRLKVKRDWYVGLHPEVVDRSNPDVHDDLLTQQAAAFHSKESNHTSDADVADIKADVAEIKADVADIKVKQNETQQNPEPPKTTSSEEHSGSPLNPSDAQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G020460`
TK1151 ID	TkA05G020460
OH-1004 ID	LXL04_019124
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G020460

Location Chr05:5597458-5602021 (+)

Description Similar to DEX1: Protein DEFECTIVE IN EXINE FORMATION 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09090`	Required for exine pattern formation during pollen development, especially for primexine deposition.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019124 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010208 pollen wall assembly Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G09090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.616

Rank 1 · TkA05G020460 · TK1151

Golgi apparatus0.356

Rank 2 · TkA05G020460 · TK1151

Cytoplasm0.164

Rank 3 · TkA05G020460 · TK1151

Cell membrane0.083

Rank 4 · TkA05G020460 · TK1151

Nucleus0.082

Rank 5 · TkA05G020460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23727Beta-prop_FAM234A_B56-90 aa

PF15907Itfg257-89 aa

PF13570Beta-prop_ACSF459-155 aa

PF13360PQQ_259-78 aa

PF25292Beta-prop_CGLA60-97 aa

PF23167DUF705764-89 aa

PF13517FG-GAP_367-89 aa

PF01839FG-GAP75-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G020460	`PF23727`	Beta-prop_FAM234A_B	56	90	0.0021	17.4
TkA05G020460	`PF15907`	Itfg2	57	89	0.0038	17.3
TkA05G020460	`PF13570`	Beta-prop_ACSF4	59	155	5.4e-11	43.1
TkA05G020460	`PF13360`	PQQ_2	59	78	0.091	13.1
TkA05G020460	`PF25292`	Beta-prop_CGLA	60	97	5.4e-09	36.7
TkA05G020460	`PF23167`	DUF7057	64	89	0.047	14.5
TkA05G020460	`PF13517`	FG-GAP_3	67	89	3.8e-17	63.4
TkA05G020460	`PF01839`	FG-GAP	75	89	3.5e-16	59.4
TkA05G020460	`PF13517`	FG-GAP_3	78	136	3.8e-17	63.4
TkA05G020460	`PF30693`	KPTN	115	151	0.0029	17.2
TkA05G020460	`PF23727`	Beta-prop_FAM234A_B	121	143	0.0021	17.4
TkA05G020460	`PF01839`	FG-GAP	122	142	3.5e-16	59.4
TkA05G020460	`PF15907`	Itfg2	123	152	0.0038	17.3
TkA05G020460	`PF14783`	BBS2_Mid	124	144	0.0014	19.4
TkA05G020460	`PF25292`	Beta-prop_CGLA	125	151	5.4e-09	36.7
TkA05G020460	`PF13517`	FG-GAP_3	126	150	3.8e-17	63.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IYM4`	Arabidopsis thaliana	sp\|F4IYM4\|DEX1_ARATH Protein DEFECTIVE IN EXINE FORMATION 1	69.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card