TkA04G410190 | RubberDandelionOmics

Gene overview

TkA04G410190

Reference: TK1151 Chr: Chr04 Coordinates: 103304738-103307347 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · TkA04G410190|TK1151|cDNA

ATGTCGTACCCTAATCATGAATTTGTAGCTTCTTCAAACAACCGTTTGATTTCTGAAGAACTATCTTATGACACCATAACTCTACAACAGGAAGCAGAGACCCTTATTGCTTCATTAACAACTAAGCAAAATTATGGTGGAACCGGTAAAACCTTCCTTTGGAAGACTTTGTCTGCAACTATAAGAACTAAAGGCCAAATTGTTTTAAATGTTGCTTCAAGTGGTATTGCTTCTCTGTTATTGACCGGAGGTAGGACAGC...

CDS

Download CDS FASTA

858 bp · TkA04G410190|TK1151|CDS

ATGTCGTACCCTAATCATGAATTTGTAGCTTCTTCAAACAACCGTTTGATTTCTGAAGAACTATCTTATGACACCATAACTCTACAACAGGAAGCAGAGACCCTTATTGCTTCATTAACAACTAAGCAAAATTATGGTGGAACCGGTAAAACCTTCCTTTGGAAGACTTTGTCTGCAACTATAAGAACTAAAGGCCAAATTGTTTTAAATGTTGCTTCAAGTGGTATTGCTTCTCTGTTATTGACCGGAGGTAGGACAGC...

Protein

Download Protein FASTA

285 aa · TkA04G410190|TK1151|PROTEIN

MSYPNHEFVASSNNRLISEELSYDTITLQQEAETLIASLTTKQNYGGTGKTFLWKTLSATIRTKGQIVLNVASSGIASLLLTGGRTAHSRFHIPLNLNEESLCFIKPNSDVSRLLKQTSLIIWDEAPMVHKHAFEALERTIKDVLTCDGVLNSHLPFGGKVIVFGGDFRQILPVVTNEFNRDLYSPDVQNGLNLSGLPKHKLILKVGIPVMLVRNIDQKNGLCNGTRLQVISMGNHVIEAMVITGSNIGHQTFISRYIIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G410190`
TK1151 ID	TkA04G410190
OH-1004 ID	LXL04_008699
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	54.000
Protein coverage (%)	TK1151 89.123 / OH-1004 25.709 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G410190`
Location	Chr04:103304738-103307347 (+)
Description	Similar to HDA5: Histone deacetylase 5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008699` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000209 protein polyubiquitination Biological Process GO:0001932 regulation of protein phosphorylation Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006476 protein deacetylation Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process GO:0006886 intracellular protein transport Biological Process GO:0007015 actin filament organization Biological Process GO:0007026 negative regulation of microtubule depolymerization Biological Process GO:0007173 epidermal growth factor receptor signaling pathway Biological Process GO:0009908 flower development Biological Process
KEGG gene cross-reference	ath:AT5G61060 ath:AT5G61070 mmu:15185 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.528

Rank 1 · TkA04G410190 · TK1151

Cytoplasm0.489

Rank 2 · TkA04G410190 · TK1151

Mitochondrion0.049

Rank 3 · TkA04G410190 · TK1151

Peroxisome0.041

Rank 4 · TkA04G410190 · TK1151

Cell membrane0.026

Rank 5 · TkA04G410190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05127NAT10_TcmA_helicase35-60 aa

PF13604AAA_3042-142 aa

PF05970PIF144-178 aa

PF13245AAA_1947-173 aa

PF05127NAT10_TcmA_helicase64-145 aa

PF13604AAA_30159-184 aa

PF21530Pif1_2B_dom189-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G410190	`PF05127`	NAT10_TcmA_helicase	35	60	0.00093	19.8
TkA04G410190	`PF13604`	AAA_30	42	142	4.5e-05	24.0
TkA04G410190	`PF05970`	PIF1	44	178	4.4e-60	203.8
TkA04G410190	`PF13245`	AAA_19	47	173	0.063	14.2
TkA04G410190	`PF05127`	NAT10_TcmA_helicase	64	145	0.00093	19.8
TkA04G410190	`PF13604`	AAA_30	159	184	4.5e-05	24.0
TkA04G410190	`PF21530`	Pif1_2B_dom	189	232	2.4e-20	72.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card