RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G358460
Reference: TK1151 Chr: Chr04 Coordinates: 90327702-90329009 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1308 bp · TkA04G358460|TK1151|cDNA

ATGTCCTCCGTCTCCGGCGTTAATACGCCTTCCACTGAAATCCCTAATCTCCATTCTCGTCCCCACCGGAAATCTGATGCCAACTGGTCCGCGATTAGAGCTGCGACGAATTTGTCCTCCGACGGTACGCTGCATCTCCGCCACCTCAAGCTGGTTCGACATGTCGGATCTGGAAACCTCGGCCGGGTGTTCCTTTGCCGACTTCGTGATTACGATCATGCGAGCTTTGCTTTGAAGGTCGTTGATAACAACTTGCTCAC...

CDS

Download CDS FASTA

1308 bp · TkA04G358460|TK1151|CDS

ATGTCCTCCGTCTCCGGCGTTAATACGCCTTCCACTGAAATCCCTAATCTCCATTCTCGTCCCCACCGGAAATCTGATGCCAACTGGTCCGCGATTAGAGCTGCGACGAATTTGTCCTCCGACGGTACGCTGCATCTCCGCCACCTCAAGCTGGTTCGACATGTCGGATCTGGAAACCTCGGCCGGGTGTTCCTTTGCCGACTTCGTGATTACGATCATGCGAGCTTTGCTTTGAAGGTCGTTGATAACAACTTGCTCAC...

Protein

Download Protein FASTA

435 aa · TkA04G358460|TK1151|PROTEIN

MSSVSGVNTPSTEIPNLHSRPHRKSDANWSAIRAATNLSSDGTLHLRHLKLVRHVGSGNLGRVFLCRLRDYDHASFALKVVDNNLLTSKKLSHVQTEGRILSSLDHPFLPTLYAHLEVSHYTCFLIDFCPNGDLHSLLRKQPNYRLPIDSVRFYAAEVLVALEYLHSLGIVYRDLKPENILIREDGHIMLSDFDLCFNADVVPKLDRRTRSRRKTKHSDCFGYYGGRRYTEQETLMEFVAEPTTAFSKSCVGTHEYLAPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G358460
TK1151 IDTkA04G358460
OH-1004 IDLXL04_037891
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)98.900
Protein coverage (%)TK1151 100.000 / OH-1004 74.359
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G358460
LocationChr04:90327702-90329009 (-)
DescriptionSimilar to WAG2: Serine/threonine-protein kinase WAG2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g53700 Serine/threonine-protein kinase involved in the regulation of auxin signaling.
The WAG1 and WAG2 protein kinases negatively regulate root waving in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02641.x
NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106
Plasma membrane-bound AGC3 kinases phosphorylate PIN auxin carriers at TPRXS(N/S) motifs to direct apical PIN recycling.2010 · DOI: 10.1242/dev.052456
At3g14370 Serine/threonine-protein kinase involved in the regulation of auxin signaling.
The WAG1 and WAG2 protein kinases negatively regulate root waving in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02641.x
NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106
Plasma membrane-bound AGC3 kinases phosphorylate PIN auxin carriers at TPRXS(N/S) motifs to direct apical PIN recycling.2010 · DOI: 10.1242/dev.052456
At4g26610 Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.
D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484

Rice

Reference gene IDPossible functionPapers / DOI
Os12g0614600 Serine/threonine-protein kinase involved in the regulation of auxin signaling. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037891 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009908 flower development Biological Process
GO:0009926 auxin polar transport Biological Process
GO:0048364 root development Biological Process
GO:0048367 shoot system development Biological Process
GO:0048825 cotyledon development Biological Process
GO:2000012 regulation of auxin polar transport Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G53700
ath:AT3G14370
dosa:Os06g0291600
dosa:Os12g0614600
osa:4340792
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.566
Rank 1 · TkA04G358460 · TK1151
Nucleus0.399
Rank 2 · TkA04G358460 · TK1151
Cell membrane0.113
Rank 3 · TkA04G358460 · TK1151
Mitochondrion0.051
Rank 4 · TkA04G358460 · TK1151
Lysosome / Vacuole0.039
Rank 5 · TkA04G358460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12260PIP49_C46-78 aa
PF13095FTA247-82 aa
PF07714PK_Tyr_Ser-Thr49-199 aa
PF00069Pkinase51-198 aa
PF13095FTA2156-181 aa
PF06293Kdo162-196 aa
PF14531Kinase-like163-194 aa
PF12260PIP49_C174-220 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G358460PF12260PIP49_C46780.1912.0
TkA04G358460PF13095FTA247820.05713.8
TkA04G358460PF07714PK_Tyr_Ser-Thr491992e-31110.0
TkA04G358460PF00069Pkinase511982.2e-56191.9
TkA04G358460PF13095FTA21561810.05713.8
TkA04G358460PF06293Kdo1621960.2311.6
TkA04G358460PF14531Kinase-like1631940.009416.0
TkA04G358460PF12260PIP49_C1742200.1912.0
TkA04G358460PF00069Pkinase2473522.2e-56191.9
TkA04G358460PF07714PK_Tyr_Ser-Thr2493362e-31110.0
TkA04G358460PF14531Kinase-like2702970.009416.0
TkA04G358460PF14531Kinase-like3613740.009416.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C8M5Arabidopsis thalianasp|Q9C8M5|WAG1_ARATH Serine/threonine-protein kinase WAG165.900%Swiss-ProtHigh
Q9LUL2Arabidopsis thalianasp|Q9LUL2|WAG2_ARATH Serine/threonine-protein kinase WAG264.800%Swiss-ProtHigh
Q9SUA3Arabidopsis thalianasp|Q9SUA3|D6KL1_ARATH Serine/threonine-protein kinase D6PKL146.400%Swiss-ProtMedium
Q2QM77Oryza sativa subsp. japonicasp|Q2QM77|PID_ORYSJ Protein kinase PINOID50.700%Swiss-ProtHigh

JBrowse

View in Genome Browser