LXL04_037891 | RubberDandelionOmics

Gene overview

LXL04_037891

Reference: OH-1004 Chr: Chr09 Coordinates: 24463815-24471429 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1758 bp · LXL04_037891|LXL04_037891|OH1004|cDNA

ATGTGTTACCATATCATGTTGGCACTTAAGCATATTTCATCGACAAAATCAAGTATTTTTACTAAACATTATATTACAATGTACTGCATGCTcccaaaaaaaaacattttctTATGCAAACATGTAAACCCCCGCCATCTCCCCCACTTCTATCACACCACCAATCAATCATCAATGGAGGACGATCACCACAATGCTCTCTCTCATCAAGACTCCGATCTCGATTTCAGCTTCACCAGCTCCACCTCCATCGCCACCAC...

CDS

Download CDS FASTA

1758 bp · LXL04_037891|LXL04_037891|OH1004|CDS

ATGTGTTACCATATCATGTTGGCACTTAAGCATATTTCATCGACAAAATCAAGTATTTTTACTAAACATTATATTACAATGTACTGCATGCTCCCAAAAAAAAACATTTTCTTATGCAAACATGTAAACCCCCGCCATCTCCCCCACTTCTATCACACCACCAATCAATCATCAATGGAGGACGATCACCACAATGCTCTCTCTCATCAAGACTCCGATCTCGATTTCAGCTTCACCAGCTCCACCTCCATCGCCACCAC...

Protein

Download Protein FASTA

585 aa · LXL04_037891|LXL04_037891|OH1004|PROTEIN

MCYHIMLALKHISSTKSSIFTKHYITMYCMLPKKNIFLCKHVNPRHLPHFYHTTNQSSMEDDHHNALSHQDSDLDFSFTSSTSIATTSARSSLARSSLCLSFNDRMSSVSGVNTPSTEIPNLHSRPHRKSDANWSAIRAATNLSSDGTLHLRHLKLVRHVGSGNLGRVFLCRLRDYDHASFALKVVDNNLLTSKKLSHVQTEGRILSSLDHPFLPTLYAHLEVSHYTCFLIDFCPNGDLHSLLRKQPNYRLPIDSVRFYA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037891`
TK1151 ID	TkA04G358460
OH-1004 ID	LXL04_037891
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 74.359 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037891

Location Chr09:24463815-24471429 (-)

Description Similar to WAG2: Serine/threonine-protein kinase WAG2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14370`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	The WAG1 and WAG2 protein kinases negatively regulate root waving in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02641.x NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106 Plasma membrane-bound AGC3 kinases phosphorylate PIN auxin carriers at TPRXS(N/S) motifs to direct apical PIN recycling.2010 · DOI: 10.1242/dev.052456
`At1g53700`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	The WAG1 and WAG2 protein kinases negatively regulate root waving in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02641.x NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106 Plasma membrane-bound AGC3 kinases phosphorylate PIN auxin carriers at TPRXS(N/S) motifs to direct apical PIN recycling.2010 · DOI: 10.1242/dev.052456

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0614600`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	No verified direct reference in this release
`UniProt: A2YBX5`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release
`Os06g0291600`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037891 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0048825 cotyledon development Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G53700

ath:AT3G14370

dosa:Os06g0291600

dosa:Os12g0614600

osa:4340792

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.499

Rank 1 · LXL04_037891 · OH-1004

Nucleus0.404

Rank 2 · LXL04_037891 · OH-1004

Cell membrane0.086

Rank 3 · LXL04_037891 · OH-1004

Mitochondrion0.081

Rank 4 · LXL04_037891 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_037891 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr154-304 aa

PF00069.32Pkinase156-303 aa

PF00069.32Pkinase352-457 aa

PF07714.24PK_Tyr_Ser-Thr354-441 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037891	`PF07714.24`	PK_Tyr_Ser-Thr	154	304	5.1e-31	108.6
LXL04_037891	`PF00069.32`	Pkinase	156	303	2.7e-56	191.6
LXL04_037891	`PF00069.32`	Pkinase	352	457	2.7e-56	191.6
LXL04_037891	`PF07714.24`	PK_Tyr_Ser-Thr	354	441	5.1e-31	108.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUL2`	Arabidopsis thaliana	Serine/threonine-protein kinase WAG2	61.905%	Swiss-Prot	strong database homology
`Q9C8M5`	Arabidopsis thaliana	Serine/threonine-protein kinase WAG1	59.175%	Swiss-Prot	strong database homology
`Q2QM77`	Oryza sativa subsp. japonica	Protein kinase PINOID	50.411%	Swiss-Prot	moderate database homology
`A2YBX5`	Oryza sativa subsp. indica	Protein kinase G11A	44.125%	Swiss-Prot	moderate database homology
`Q0DCT8`	Oryza sativa subsp. japonica	Protein kinase G11A	44.125%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card