TkA04G130610 | RubberDandelionOmics

Gene overview

TkA04G130610

Reference: TK1151 Chr: Chr04 Coordinates: 34039958-34042439 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1374 bp · TkA04G130610|TK1151|cDNA

GGGTGTGGGATTCCCGTTTCATTGACCCGACCCGAACTCTCCCCCTGTTCTTGTTCTGTTCCTGTTCCTCACATTTCAGATTCCTTTTTCTACTTTTCCAATTCTCCGATCCCTCTTCCTCTTTTCAACTTATAAAAGGCGATACTATCTTTCTTTCGACCTAATCTCGGCGCTCAACGATGTGTTTTGGTGACTTCTGCATGTCCCTTGTGGTTGAGTTACAGAAATGGAAGGGAAAGCCATTGCCATACATCAAACTT...

CDS

Download CDS FASTA

600 bp · TkA04G130610|TK1151|CDS

ATGGCGATCTTTTTCCCATCAGATATGAAATTGAATTCTTCCACAATGTTGTTCATGACGCGAATAGTTTCTTGGGGAGCAGTTGACCGCAATCGTCCTAATGGTCAAAGTGATGAACTTATTGGATTTGTGACTGCAAGAATTGTAATGGCAAAAGAAAGTGAGATAGAAGATATGCTGAGATATGACAAATCAAGATCAGATCAAACTCTAGTTTATATTCTGACTCTAGGTGTGGTAGAGTCTTATAGAAATTTTGG...

Protein

Download Protein FASTA

199 aa · TkA04G130610|TK1151|PROTEIN

MAIFFPSDMKLNSSTMLFMTRIVSWGAVDRNRPNGQSDELIGFVTARIVMAKESEIEDMLRYDKSRSDQTLVYILTLGVVESYRNFGIATSLIREVIKYASTMQNCRAVYLHVISYNNSAIHLYQKMSFLCVRRLHAFYSSMANIMMHTCSYTMSMVAGLHVHLRACYTSSNIHEERIEDGIFKSMEKGRKEWPKESQI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G130610`
TK1151 ID	TkA04G130610
OH-1004 ID	LXL04_035445
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 59.296 / OH-1004 46.275 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G130610

Location Chr04:34039958-34042439 (-)

Description Similar to MCC1: Histone acetyltransferase MCC1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02980`	Histone acetyltransferase that probably regulates acetylation status of histone H3 during meiosis.	Histone hyperacetylation affects meiotic recombination and chromosome segregation in Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04191.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035445 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006334 nucleosome assembly Biological Process

GO:0006474 N-terminal protein amino acid acetylation Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0017196 N-terminal peptidyl-methionine acetylation Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004402 histone acetyltransferase activity Molecular Function

GO:0004596 protein-N-terminal amino-acid acetyltransferase activity Molecular Function

GO:0010485 histone H4 acetyltransferase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G02980

bta:514154

dre:570640

mmu:74763

rno:363545

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.445

Rank 1 · TkA04G130610 · TK1151

Nucleus0.356

Rank 2 · TkA04G130610 · TK1151

Endoplasmic reticulum0.110

Rank 3 · TkA04G130610 · TK1151

Mitochondrion0.104

Rank 4 · TkA04G130610 · TK1151

Cell membrane0.103

Rank 5 · TkA04G130610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583Acetyltransf_137-129 aa

PF13508Acetyltransf_748-129 aa

PF14542Acetyltransf_CG59-102 aa

PF17013Acetyltransf_1564-130 aa

PF13673Acetyltransf_1067-131 aa

PF08445FR4773-129 aa

PF13420Acetyltransf_474-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G130610	`PF00583`	Acetyltransf_1	37	129	1.7e-14	54.8
TkA04G130610	`PF13508`	Acetyltransf_7	48	129	4.4e-07	30.9
TkA04G130610	`PF14542`	Acetyltransf_CG	59	102	0.065	14.1
TkA04G130610	`PF17013`	Acetyltransf_15	64	130	0.029	14.5
TkA04G130610	`PF13673`	Acetyltransf_10	67	131	0.016	15.9
TkA04G130610	`PF08445`	FR47	73	129	0.00065	20.4
TkA04G130610	`PF13420`	Acetyltransf_4	74	139	0.00013	22.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8T9`	Arabidopsis thaliana	sp\|Q9M8T9\|MCC1_ARATH Histone acetyltransferase MCC1	67.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card