LXL04_035445 | RubberDandelionOmics

Gene overview

LXL04_035445

Reference: OH-1004 Chr: Chr08 Coordinates: 22577392-22578740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · LXL04_035445|LXL04_035445|OH1004|cDNA

ATGATGAACTTGAGAGCACCCCGCCATCCATCCATCTCTTACAGACCTATACAACCCAATGATCTTGAAGTTCTTGTAAAAATCCATGGCGATCTTTTTCCCATCAGATATGAAATTGAATTCTTCCACAATGTTGTTCATGGACGCGATATAGTTTCTTGGGGAGCAGTTGACCGCAATCGTCCTAATGGTCAAAGTGATGAACTTATTGGATTTGTGACTGCAAGAATTGTAATGGCAAAAGAAAGTGAGATAGAAGA...

CDS

Download CDS FASTA

768 bp · LXL04_035445|LXL04_035445|OH1004|CDS

ATGATGAACTTGAGAGCACCCCGCCATCCATCCATCTCTTACAGACCTATACAACCCAATGATCTTGAAGTTCTTGTAAAAATCCATGGCGATCTTTTTCCCATCAGATATGAAATTGAATTCTTCCACAATGTTGTTCATGGACGCGATATAGTTTCTTGGGGAGCAGTTGACCGCAATCGTCCTAATGGTCAAAGTGATGAACTTATTGGATTTGTGACTGCAAGAATTGTAATGGCAAAAGAAAGTGAGATAGAAGA...

Protein

Download Protein FASTA

255 aa · LXL04_035445|LXL04_035445|OH1004|PROTEIN

MMNLRAPRHPSISYRPIQPNDLEVLVKIHGDLFPIRYEIEFFHNVVHGRDIVSWGAVDRNRPNGQSDELIGFVTARIVMAKESEIEDMLRYDKSRSDQTLVYILTLGVVESYRNFGIATSLIREVIKYASTMQNCRAVYLHVISYNNSAIHLYQKMSFLCVRRLHAFYFINGQHYDAYLFIYYVNGGRSPCSPLELVTLLVTYMRRGLKMVSSRVWKKGEKNGQKRVKYRDKGTLLPMTQNKRSISIEGPENDHV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035445`
TK1151 ID	TkA04G130610
OH-1004 ID	LXL04_035445
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 59.296 / OH-1004 46.275 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035445

Location Chr08:22577392-22578740 (+)

Description Similar to MCC1: Histone acetyltransferase MCC1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02980`	Histone acetyltransferase that probably regulates acetylation status of histone H3 during meiosis.	Histone hyperacetylation affects meiotic recombination and chromosome segregation in Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04191.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035445 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006334 nucleosome assembly Biological Process

GO:0006474 N-terminal protein amino acid acetylation Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0017196 N-terminal peptidyl-methionine acetylation Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004402 histone acetyltransferase activity Molecular Function

GO:0004596 protein-N-terminal amino-acid acetyltransferase activity Molecular Function

GO:0010485 histone H4 acetyltransferase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G02980

bta:514154

dre:570640

mmu:74763

rno:363545

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.399

Rank 1 · LXL04_035445 · OH-1004

Nucleus0.283

Rank 2 · LXL04_035445 · OH-1004

Mitochondrion0.143

Rank 3 · LXL04_035445 · OH-1004

Cell membrane0.116

Rank 4 · LXL04_035445 · OH-1004

Endoplasmic reticulum0.113

Rank 5 · LXL04_035445 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583.32Acetyltransf_160-158 aa

PF13508.14Acetyltransf_778-158 aa

PF13420.14Acetyltransf_4103-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035445	`PF00583.32`	Acetyltransf_1	60	158	1.4e-14	55.1
LXL04_035445	`PF13508.14`	Acetyltransf_7	78	158	7.3e-07	30.2
LXL04_035445	`PF13420.14`	Acetyltransf_4	103	177	3.9e-08	34.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8T9`	Arabidopsis thaliana	Histone acetyltransferase MCC1	60.619%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card