TkA03G572920 | RubberDandelionOmics

Gene overview

TkA03G572920

Reference: TK1151 Chr: Chr03 Coordinates: 145305802-145306377 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

576 bp · TkA03G572920|TK1151|cDNA

ATGCTGAGAAAACACACATACAATGATGAACTGGAGCAAAGTAAAAGAAACTCCGCCGTCGACAAAACCATTTCACGAACTGGGTTTAATTCTCCTTCCGGTTCTATTACCGTTAAGCCACGAGAACACCTCTTCCAGAAGACTGTTACCCCAAGTGACGTCGGGAAACTGAACCGGCTCGTGATACCAAAACAACACGCAGAAAAACACTTTCCGGTTCAGAGAGGAAGCACTTCAAAAGGAGTTCTTTTACATTTCGA...

CDS

Download CDS FASTA

576 bp · TkA03G572920|TK1151|CDS

ATGCTGAGAAAACACACATACAATGATGAACTGGAGCAAAGTAAAAGAAACTCCGCCGTCGACAAAACCATTTCACGAACTGGGTTTAATTCTCCTTCCGGTTCTATTACCGTTAAGCCACGAGAACACCTCTTCCAGAAGACTGTTACCCCAAGTGACGTCGGGAAACTGAACCGGCTCGTGATACCAAAACAACACGCAGAAAAACACTTTCCGGTTCAGAGAGGAAGCACTTCAAAAGGAGTTCTTTTACATTTCGA...

Protein

Download Protein FASTA

191 aa · TkA03G572920|TK1151|PROTEIN

MLRKHTYNDELEQSKRNSAVDKTISRTGFNSPSGSITVKPREHLFQKTVTPSDVGKLNRLVIPKQHAEKHFPVQRGSTSKGVLLHFEDIDSKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLNAGDSVSFQRSTGPEKQLYIDWKAKTGSDSTNIQPIQPVNRFRCYGYLGLTFRVLLTAMAREVIQKWIY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G572920`
TK1151 ID	TkA03G572920
OH-1004 ID	LXL04_021401
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.400
Protein coverage (%)	TK1151 87.958 / OH-1004 49.552 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G572920

Location Chr03:145305802-145306377 (+)

Description Similar to RAV1: AP2/ERF and B3 domain-containing transcription factor RAV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68840`	Probably acts as a transcriptional activator.	The balance between CONSTANS and TEMPRANILLO activities determines FT expression to trigger flowering.2008 · DOI: 10.1016/j.cub.2008.07.075
`At1g13260`	Binds specifically to bipartite recognition sequences composed of two unrelated motifs, 5'-CAACA-3' and 5'-CACCTG-3'.	Arabidopsis RAV1 is down-regulated by brassinosteroid and may act as a negative regulator during plant development.2004 · DOI: 10.1038/sj.cr.7290197 RAV1, a novel DNA-binding protein, binds to bipartite recognition sequence through two distinct DNA-binding domains uniquely found in higher plants.1999 · DOI: 10.1093/nar/27.2.470
`At1g25560`	Transcriptional repressor of flowering time on long day plants.	The balance between CONSTANS and TEMPRANILLO activities determines FT expression to trigger flowering.2008 · DOI: 10.1016/j.cub.2008.07.075
`At3g25730`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0693400`	AP2/ERF and B3 domain-containing protein Os01g0693400.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021401 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048366 leaf development Biological Process

GO:0048527 lateral root development Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G13260

ath:AT1G25560

ath:AT1G68840

ath:AT3G25730

dosa:Os01g0693400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.930

Rank 1 · TkA03G572920 · TK1151

Cytoplasm0.130

Rank 2 · TkA03G572920 · TK1151

Cell membrane0.029

Rank 3 · TkA03G572920 · TK1151

Endoplasmic reticulum0.019

Rank 4 · TkA03G572920 · TK1151

Mitochondrion0.013

Rank 5 · TkA03G572920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B345-143 aa

PF31239At5g26805_C46-131 aa

PF12790T6SS-SciN59-99 aa

PF03754At2g31720-like79-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G572920	`PF02362`	B3	45	143	1.1e-26	93.4
TkA03G572920	`PF31239`	At5g26805_C	46	131	2.6e-07	31.8
TkA03G572920	`PF12790`	T6SS-SciN	59	99	0.016	15.7
TkA03G572920	`PF03754`	At2g31720-like	79	129	0.00032	21.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P82280`	Arabidopsis thaliana	sp\|P82280\|RAV2_ARATH AP2/ERF and B3 domain-containing transcription repressor RAV2	63.800%	Swiss-Prot	High
`Q9ZWM9`	Arabidopsis thaliana	sp\|Q9ZWM9\|RAV1_ARATH AP2/ERF and B3 domain-containing transcription factor RAV1	66.900%	Swiss-Prot	High
`Q9C6M5`	Arabidopsis thaliana	sp\|Q9C6M5\|RAVL1_ARATH AP2/ERF and B3 domain-containing transcription repressor TEM1	60.800%	Swiss-Prot	High
`Q9LS06`	Arabidopsis thaliana	sp\|Q9LS06\|RAVL4_ARATH AP2/ERF and B3 domain-containing transcription factor ARF14	58.500%	Swiss-Prot	High
`Q8RZX9`	Oryza sativa subsp. japonica	sp\|Q8RZX9\|Y1934_ORYSJ AP2/ERF and B3 domain-containing protein Os01g0693400	55.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card