TkA03G535210 | RubberDandelionOmics

Gene overview

TkA03G535210

Reference: TK1151 Chr: Chr03 Coordinates: 134680070-134683979 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1450 bp · TkA03G535210|TK1151|cDNA

CAGGGCTGCAGTTGCAACGTCGACATTCACGCGGTACAGAAGAAATCGCAATAGATACCGTAAAGAGAGGAGAGTGAAAGGGGCACCAAAAAGAGTACCCCAAAACCCCTAAAACCACTTCTGATTTCGAACCCTAATTTGTAAAAGCTCTTTGAATTTTCTACACCTGCTATTGATTCCGATAATTAGTTATACGAAGTTGTGATCTCGCACTGTAGAGATCATCTTCGTCGTCATGGATATCGAACAAAAGCAAGCGG...

CDS

Download CDS FASTA

750 bp · TkA03G535210|TK1151|CDS

ATGGATATCGAACAAAAGCAAGCGGAGCACATCGAGCACTTCGTGAAACAAGCGTCCAGCAATCAGACTTCATCATCTTATCTCGCAAATGTCATCGTGGAAGCCACTTCACACCCTTCTCTCTTTGCTTTCTCCGAGATTCTTGCTCTCCCTAAGATCCTCGAGCTTCAAGGAACGGAGCATTCTATATACCTTGATTTGCTTCAGATGTTTGCTCATGGAACATGGAGTGAATACAAAAGTAGTGCTAGCAGGCTTCC...

Protein

Download Protein FASTA

249 aa · TkA03G535210|TK1151|PROTEIN

MDIEQKQAEHIEHFVKQASSNQTSSSYLANVIVEATSHPSLFAFSEILALPKILELQGTEHSIYLDLLQMFAHGTWSEYKSSASRLPLLTPDQILKLKQLTMLTLAEANKVLSYDVLMHELDVVNVRELEDFLINECMYVGIVRGKLDQLRRCFEVQFAAGRDLRPGQLGNMIHTLSDWLGTSDNLLISIQDKIKWADTMSELDRKHKKENEERLEEVKNALSLKKLQTVSRLTWSSEGTGGFSLNLVE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G535210`
TK1151 ID	TkA03G535210
OH-1004 ID	LXL04_010547
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.900
Protein coverage (%)	TK1151 97.189 / OH-1004 90.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G535210

Location Chr03:134680070-134683979 (-)

Description Similar to CSN7: COP9 signalosome complex subunit 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02090`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	The Arabidopsis COP9 signalosome subunit 7 is a model PCI domain protein with subdomains involved in COP9 signalosome assembly.2008 · DOI: 10.1105/tpc.107.053801 COP9 signalosome subunit 7 from Arabidopsis interacts with and regulates the small subunit of ribonucleotide reductase (RNR2).2011 · DOI: 10.1007/s11103-011-9795-8

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010547 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000338 protein deneddylation Biological Process

GO:0007281 germ cell development Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0010387 COP9 signalosome assembly Biological Process

GO:0036099 female germ-line stem cell population maintenance Biological Process

GO:0050821 protein stabilization Biological Process

GO:2000434 regulation of protein neddylation Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008180 COP9 signalosome Cellular Component

KEGG gene cross-reference

ath:AT1G02090

ddi:DDB_G0271282

dme:Dmel_CG2038

hsa:64708

mmu:26895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.659

Rank 1 · TkA03G535210 · TK1151

Nucleus0.493

Rank 2 · TkA03G535210 · TK1151

Golgi apparatus0.056

Rank 3 · TkA03G535210 · TK1151

Lysosome / Vacuole0.048

Rank 4 · TkA03G535210 · TK1151

Cell membrane0.040

Rank 5 · TkA03G535210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22642MinC_N_14-19 aa

PF22061CSN7_HB_subdom12-45 aa

PF01399PCI89-157 aa

PF18392CSN7a_helixI169-213 aa

PF22642MinC_N_1181-217 aa

PF01399PCI211-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G535210	`PF22642`	MinC_N_1	4	19	0.19	12.8
TkA03G535210	`PF22061`	CSN7_HB_subdom	12	45	6.5e-05	23.4
TkA03G535210	`PF01399`	PCI	89	157	4.4e-05	24.3
TkA03G535210	`PF18392`	CSN7a_helixI	169	213	0.001	19.6
TkA03G535210	`PF22642`	MinC_N_1	181	217	0.19	12.8
TkA03G535210	`PF01399`	PCI	211	228	4.4e-05	24.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JU3`	Arabidopsis thaliana	sp\|Q94JU3\|CSN7_ARATH COP9 signalosome complex subunit 7	75.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card