LXL04_010547 | RubberDandelionOmics

Gene overview

LXL04_010547

Reference: OH-1004 Chr: Chr02 Coordinates: 148885790-148889053 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

810 bp · LXL04_010547|LXL04_010547|OH1004|cDNA

ATGGATATCGAACAAAAGCAAGCGGAGCACATCGAGCACTTCGTGAAACAAGCGTCCAGCAATCAGACTTCATCATCTTATCTCGCAAATGTCATCGTGGAAGCCACTTCACACCCTTCTCTCTTTGCTTTCTCCGAGATTCTTGCTCTCCCTAAGATCCTCGAGCTTCAAGGAACGGAGCATTCTATATACCTTGATTTGCTTCAGATGTTTGCTCATGGAACATGGAGTGAATACAAAAGTAGTGCTAGCAGGCTTCC...

CDS

Download CDS FASTA

810 bp · LXL04_010547|LXL04_010547|OH1004|CDS

ATGGATATCGAACAAAAGCAAGCGGAGCACATCGAGCACTTCGTGAAACAAGCGTCCAGCAATCAGACTTCATCATCTTATCTCGCAAATGTCATCGTGGAAGCCACTTCACACCCTTCTCTCTTTGCTTTCTCCGAGATTCTTGCTCTCCCTAAGATCCTCGAGCTTCAAGGAACGGAGCATTCTATATACCTTGATTTGCTTCAGATGTTTGCTCATGGAACATGGAGTGAATACAAAAGTAGTGCTAGCAGGCTTCC...

Protein

Download Protein FASTA

269 aa · LXL04_010547|LXL04_010547|OH1004|PROTEIN

MDIEQKQAEHIEHFVKQASSNQTSSSYLANVIVEATSHPSLFAFSEILALPKILELQGTEHSIYLDLLQMFAHGTWSEYKSSASRLPLLTPDQILKLKQLTMLTLAEANKVLSYDVLMHELDVVNVRELEDFLINECMYVGIVRGKLDQLRRCFEVQFAAGRDLRPGQLGNMIHTLSDWLGTSDNLLISIQDKIKWADTMSELDRKHKKENEERLEEVKNALSLKVRKVTNCQQADMEFRGHGGLFAEPGGVMDYDEDRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010547`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010547

Location Chr02:148885790-148889053 (-)

Description Similar to CSN7: COP9 signalosome complex subunit 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02090`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	The Arabidopsis COP9 signalosome subunit 7 is a model PCI domain protein with subdomains involved in COP9 signalosome assembly.2008 · DOI: 10.1105/tpc.107.053801 COP9 signalosome subunit 7 from Arabidopsis interacts with and regulates the small subunit of ribonucleotide reductase (RNR2).2011 · DOI: 10.1007/s11103-011-9795-8

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010547 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000338 protein deneddylation Biological Process

GO:0007281 germ cell development Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0010387 COP9 signalosome assembly Biological Process

GO:0036099 female germ-line stem cell population maintenance Biological Process

GO:0050821 protein stabilization Biological Process

GO:2000434 regulation of protein neddylation Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008180 COP9 signalosome Cellular Component

KEGG gene cross-reference

ath:AT1G02090

ddi:DDB_G0271282

dme:Dmel_CG2038

hsa:64708

mmu:26895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.617

Rank 1 · LXL04_010547 · OH-1004

Nucleus0.610

Rank 2 · LXL04_010547 · OH-1004

Lysosome / Vacuole0.033

Rank 3 · LXL04_010547 · OH-1004

Golgi apparatus0.033

Rank 4 · LXL04_010547 · OH-1004

Cell membrane0.031

Rank 5 · LXL04_010547 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JU3`	Arabidopsis thaliana	COP9 signalosome complex subunit 7	70.260%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card