TkA03G530540 | RubberDandelionOmics

Gene overview

TkA03G530540

Reference: TK1151 Chr: Chr03 Coordinates: 133398109-133400956 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1552 bp · TkA03G530540|TK1151|cDNA

CCTAAACAAATGATAGAAGACGACCAAACATTCCACTTTCCATATTTTTAATTGCACGAATTAGAAAAACCCACCCCAAACCATACAGACACACATCCCAACACACATGTATAACACACCAACATCTTCACATCAATCTTCATCTCAATTTCTTAATTTTCACCAGTATACTTCATTACTTCCAATCTCAGTTTCTCTGCAAATAATAACGCTTTCCTCTAGCTGCAACAGATATCTATCCATCTAACATGATGAAGATT...

CDS

Download CDS FASTA

1011 bp · TkA03G530540|TK1151|CDS

ATGATGAAGATTGGGAGAAGAGGATTACATTATTTACACACATTAAACAGTGTTCCTAAGAATTTGATAGAGAAGGGACAAAACCGTGTTATAGAGGCATCTCTTACACTCATTCGTGAAAGAGCAAAACTTAAGGGAGAGCTAGTCCGTGCATTAGGTGGTGCCAAAGCTTCATCATCTCTTCTTGGAGTTCCTCTTGGACACAATTCATCCTTTCTTCAAGGTCCTGCATTTGCCCCACCAAGGATACGAGAAGCCAT...

Protein

Download Protein FASTA

336 aa · TkA03G530540|TK1151|PROTEIN

MMKIGRRGLHYLHTLNSVPKNLIEKGQNRVIEASLTLIRERAKLKGELVRALGGAKASSSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNATTEEGKELKDPRILTDVGDVPVQELRDCGIDDDRLMNIISESVKLVMEESPLRPLVLGGDHSISYPVIRAVSEKLGGPVDVLHLDAHPDIYDCFEGNKYSHASSFARIMEGGYARRLLQVGIRSINIEGREQGKRFGVEQYEMRTFSKDRHFLENLKLGEGVKGVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G530540`
TK1151 ID	TkA03G530540
OH-1004 ID	LXL04_010488
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G530540

Location Chr03:133398109-133400956 (+)

Description Similar to ARGAH1: Arginase 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g08900`	Hydrolyzes L-arginine to urea and L-ornithine; the former is involved in recycling of nitrogen into ammonium and the latter feeds back into the urea cycle or serves as a precursor for polyamine and proline synthesis.	Dual functioning of plant arginases provides a third route for putrescine synthesis.2017 · DOI: 10.1016/j.plantsci.2017.05.011
`At4g08870`	Hydrolyzes L-arginine to urea and L-ornithine; the former is involved in recycling of nitrogen into ammonium and the latter feeds back into the urea cycle or serves as a precursor for polyamine and proline synthesis.	Dual functioning of plant arginases provides a third route for putrescine synthesis.2017 · DOI: 10.1016/j.plantsci.2017.05.011 Phosphatidic acid binds to and stimulates the activity of ARGAH2 from Arabidopsis.2022 · DOI: 10.1016/j.plaphy.2022.06.018

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AU84`	Hydrolyzes L-arginine to urea and L-ornithine; the former is involved in recycling of nitrogen into ammonium and the latter feeds back into the urea cycle or serves as a precursor for polyamine and proline synthesis.	No verified direct reference in this release
`Os04g0106300`	Hydrolyzes L-arginine to urea and L-ornithine; the former is involved in recycling of nitrogen into ammonium and the latter feeds back into the urea cycle or serves as a precursor for polyamine and proline synthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010488 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000050 urea cycle Biological Process

GO:0006527 L-arginine catabolic process Biological Process

GO:0006560 proline metabolic process Biological Process

GO:0006570 tyrosine metabolic process Biological Process

GO:0006591 ornithine metabolic process Biological Process

GO:0009445 putrescine metabolic process Biological Process

GO:0009446 putrescine biosynthetic process Biological Process

GO:0033389 putrescine biosynthetic process from arginine, via agmatine Biological Process

GO:0034214 protein hexamerization Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G08870

ath:AT4G08900

dosa:Os04g0106300

mtr:11420737

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.366

Rank 1 · TkA03G530540 · TK1151

Mitochondrion0.275

Rank 2 · TkA03G530540 · TK1151

Nucleus0.162

Rank 3 · TkA03G530540 · TK1151

Plastid0.153

Rank 4 · TkA03G530540 · TK1151

Peroxisome0.140

Rank 5 · TkA03G530540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18854baeRF_family1022-54 aa

PF00491Arginase60-330 aa

PF18854baeRF_family10128-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G530540	`PF18854`	baeRF_family10	22	54	0.21	12.6
TkA03G530540	`PF00491`	Arginase	60	330	4.8e-71	240.2
TkA03G530540	`PF18854`	baeRF_family10	128	160	0.21	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46637`	Arabidopsis thaliana	sp\|P46637\|ARGI1_ARATH Arginase 1, mitochondrial	90.500%	Swiss-Prot	High
`Q9ZPF5`	Arabidopsis thaliana	sp\|Q9ZPF5\|ARGI2_ARATH Arginase 2, chloroplastic/mitochondrial	81.700%	Swiss-Prot	High
`B8AU84`	Oryza sativa subsp. indica	sp\|B8AU84\|ARGI1_ORYSI Arginase 1, mitochondrial	84.700%	Swiss-Prot	High
`Q7X7N2`	Oryza sativa subsp. japonica	sp\|Q7X7N2\|ARGI1_ORYSJ Arginase 1, mitochondrial	84.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card