LXL04_010488 | RubberDandelionOmics

Gene overview

LXL04_010488

Reference: OH-1004 Chr: Chr02 Coordinates: 147663225-147664771 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1011 bp · LXL04_010488|LXL04_010488|OH1004|cDNA

ATGATGAAGATTGGGAGAAGAGGATTACATTATTTACACACATTAAACAGTGTTCCTAAGAATTTGATAGAGAAGGGACAAAACCGTGTTATAGAGGCATCTCTTACACTCATTCGTGAAAGAGCAAAACTTAAGGGAGAGCTAGTCCGTGCACTAGGTGGTGCCAAAGCTTCATCATCTCTTCTTGGAGTTCCTCTTGGACACAATTCATCCTTTCTTCAAGGTCCTGCATTTGCCCCACCAAGGATACGAGAAGCCAT...

CDS

Download CDS FASTA

1011 bp · LXL04_010488|LXL04_010488|OH1004|CDS

ATGATGAAGATTGGGAGAAGAGGATTACATTATTTACACACATTAAACAGTGTTCCTAAGAATTTGATAGAGAAGGGACAAAACCGTGTTATAGAGGCATCTCTTACACTCATTCGTGAAAGAGCAAAACTTAAGGGAGAGCTAGTCCGTGCACTAGGTGGTGCCAAAGCTTCATCATCTCTTCTTGGAGTTCCTCTTGGACACAATTCATCCTTTCTTCAAGGTCCTGCATTTGCCCCACCAAGGATACGAGAAGCCAT...

Protein

Download Protein FASTA

336 aa · LXL04_010488|LXL04_010488|OH1004|PROTEIN

MMKIGRRGLHYLHTLNSVPKNLIEKGQNRVIEASLTLIRERAKLKGELVRALGGAKASSSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNATTEEGKELKDPRILTDVGDVPVQELRDCGIDDDRLMNIISESVKLVMEESPLRPLVLGGDHSISYPVIRAVSEKLGGPVDVLHLDAHPDIYDCFEGNKYSHASSFARIMEGGYARRLLQVGIRSINSEGREQGKRFGVEQYEMRTFSKDRHFLENLKLGEGVKGVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010488`
TK1151 ID	TkA03G530540
OH-1004 ID	LXL04_010488
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010488

Location Chr02:147663225-147664771 (+)

Description Similar to ARGAH1: Arginase 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g08900`	Hydrolyzes L-arginine to urea and L-ornithine; the former is involved in recycling of nitrogen into ammonium and the latter feeds back into the urea cycle or serves as a precursor for polyamine and proline synthesis.	Dual functioning of plant arginases provides a third route for putrescine synthesis.2017 · DOI: 10.1016/j.plantsci.2017.05.011
`At4g08870`	Hydrolyzes L-arginine to urea and L-ornithine; the former is involved in recycling of nitrogen into ammonium and the latter feeds back into the urea cycle or serves as a precursor for polyamine and proline synthesis.	Dual functioning of plant arginases provides a third route for putrescine synthesis.2017 · DOI: 10.1016/j.plantsci.2017.05.011 Phosphatidic acid binds to and stimulates the activity of ARGAH2 from Arabidopsis.2022 · DOI: 10.1016/j.plaphy.2022.06.018

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AU84`	Hydrolyzes L-arginine to urea and L-ornithine; the former is involved in recycling of nitrogen into ammonium and the latter feeds back into the urea cycle or serves as a precursor for polyamine and proline synthesis.	No verified direct reference in this release
`Os04g0106300`	Hydrolyzes L-arginine to urea and L-ornithine; the former is involved in recycling of nitrogen into ammonium and the latter feeds back into the urea cycle or serves as a precursor for polyamine and proline synthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010488 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000050 urea cycle Biological Process

GO:0006527 L-arginine catabolic process Biological Process

GO:0006560 proline metabolic process Biological Process

GO:0006570 tyrosine metabolic process Biological Process

GO:0006591 ornithine metabolic process Biological Process

GO:0009445 putrescine metabolic process Biological Process

GO:0009446 putrescine biosynthetic process Biological Process

GO:0033389 putrescine biosynthetic process from arginine, via agmatine Biological Process

GO:0034214 protein hexamerization Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G08870

ath:AT4G08900

dosa:Os04g0106300

mtr:11420737

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.376

Rank 1 · LXL04_010488 · OH-1004

Mitochondrion0.274

Rank 2 · LXL04_010488 · OH-1004

Nucleus0.168

Rank 3 · LXL04_010488 · OH-1004

Plastid0.148

Rank 4 · LXL04_010488 · OH-1004

Peroxisome0.131

Rank 5 · LXL04_010488 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00491.27Arginase60-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010488	`PF00491.27`	Arginase	60	330	4.3e-71	240.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46637`	Arabidopsis thaliana	Arginase 1, mitochondrial	90.828%	Swiss-Prot	strong database homology
`Q9ZPF5`	Arabidopsis thaliana	Arginase 2, chloroplastic/mitochondrial	81.977%	Swiss-Prot	strong database homology
`B8AU84`	Oryza sativa subsp. indica	Arginase 1, mitochondrial	85.030%	Swiss-Prot	strong database homology
`Q7X7N2`	Oryza sativa subsp. japonica	Arginase 1, mitochondrial	85.030%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card