TkA03G498280 | RubberDandelionOmics

Gene overview

TkA03G498280

Reference: TK1151 Chr: Chr03 Coordinates: 125027759-125029490 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1318 bp · TkA03G498280|TK1151|cDNA

TTTCAATTCAACTAATACCTGACAATTAACCACTCTCTCTGAATTAAGCACCCAAGATGGAACCCATCTTTCTATCGCTCCTGCTTTTCCTCGTGCCTTATGCTTTTGGAGCAGAATATTCATCCTTCAATTGCATCTCCAATAAAACCACCTACACTCAAAACACTACTTACCATCTTAACCTTAATGAACTCCTGTCTTCCTTTTCCACTGAAGAAGTAGTAATCACCGATCTTTTTTCTTACAAAATCGCCGGCAGC...

CDS

Download CDS FASTA

684 bp · TkA03G498280|TK1151|CDS

ATGTACACAGGATTTAACGGTTTTGAGTGTGATCAGTGCCTTCGAAGTGGTGTGAATCGGTTGGTGAATGAGTTATGTGGTGCGAAACTTGGGGGTCGGATATCGACTCCTAGTTGTAATCTTAGATATGAAATTTATGAGTTTTACAAGTTTCCATCTTCAGATGATGGTCTGAAAGTACCATCTTCATTAACAAAAGGAAAAACCAAGACTTCATCTGTAAAATTGGCTGCCATTCTTTCTCCGATCGTCGTTTTATT...

Protein

Download Protein FASTA

227 aa · TkA03G498280|TK1151|PROTEIN

MYTGFNGFECDQCLRSGVNRLVNELCGAKLGGRISTPSCNLRYEIYEFYKFPSSDDGLKVPSSLTKGKTKTSSVKLAAILSPIVVLLVLVGIYFSLKVWKGRRKHVRRKDSLHGTGDVEIVNEQSLQIDLETIEAATDSFSKDKKLGEGGFGGVYEGVLPSGGKIAVKRLSKGSGQGAQEFKNEVVLLAKLQHRNLVRLLGFCLEAEEKILIYEYVPNKSLDYFLFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G498280`
TK1151 ID	TkA03G498280
OH-1004 ID	LXL04_010102
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 97.357 / OH-1004 48.148 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G498280

Location Chr03:125027759-125029490 (-)

Description Similar to CRK25: Cysteine-rich receptor-like protein kinase 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23270`	Cysteine-rich receptor-like protein kinase 19.	No verified direct reference in this release
`At4g23280`	Putative cysteine-rich receptor-like protein kinase 20.	No verified direct reference in this release
`At4g23180`	Cysteine-rich receptor-like protein kinase 10.	No verified direct reference in this release
`At4g11480`	Putative cysteine-rich receptor-like protein kinase 32.	No verified direct reference in this release
`At4g23130`	Involved in multiple distinct defense responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010102 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0012501 programmed cell death Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G05200

ath:AT4G21410

ath:AT4G23230

ath:AT4G23280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.835

Rank 1 · TkA03G498280 · TK1151

Endoplasmic reticulum0.104

Rank 2 · TkA03G498280 · TK1151

Cytoplasm0.072

Rank 3 · TkA03G498280 · TK1151

Nucleus0.041

Rank 4 · TkA03G498280 · TK1151

Lysosome / Vacuole0.039

Rank 5 · TkA03G498280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung9-45 aa

PF00069Pkinase140-224 aa

PF07714PK_Tyr_Ser-Thr142-225 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G498280	`PF01657`	Stress-antifung	9	45	0.031	15.6
TkA03G498280	`PF00069`	Pkinase	140	224	6.4e-13	49.4
TkA03G498280	`PF07714`	PK_Tyr_Ser-Thr	142	225	8.7e-16	58.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWJ7`	Arabidopsis thaliana	sp\|Q8GWJ7\|CRK19_ARATH Cysteine-rich receptor-like protein kinase 19	51.400%	Swiss-Prot	High
`O65479`	Arabidopsis thaliana	sp\|O65479\|CRK20_ARATH Putative cysteine-rich receptor-like protein kinase 20	48.500%	Swiss-Prot	Medium
`Q8GYA4`	Arabidopsis thaliana	sp\|Q8GYA4\|CRK10_ARATH Cysteine-rich receptor-like protein kinase 10	46.900%	Swiss-Prot	Medium
`Q9LDS6`	Arabidopsis thaliana	sp\|Q9LDS6\|CRK32_ARATH Putative cysteine-rich receptor-like protein kinase 32	46.000%	Swiss-Prot	Medium
`Q9C5S8`	Arabidopsis thaliana	sp\|Q9C5S8\|CRK5_ARATH Cysteine-rich receptor-like protein kinase 5	48.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card