TkA03G457570 | RubberDandelionOmics

Gene overview

TkA03G457570

Reference: TK1151 Chr: Chr03 Coordinates: 114205401-114208822 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2148 bp · TkA03G457570|TK1151|cDNA

CGGAGGAAGACTGCAACGACTTTCCCGGATAAACCGAGTGGCAGAAATACAGAGACTTTCAACACCGATTCCTTTCCATTCCAAATAATTGCATTTCACTCGGATTTCTTCTTTAATCATTACGCTTTCTTGATTCCATTCCATTCCACCCATCTTCTCTCCTACTCCCTTCTTTGCTCGTGATCGGGAGCTTCAATTTAGCTCTCGATCGAGCTCACCTCCTTTTCCCCTTTTGTTCCACCTCTTTCAATGGCATCATC...

CDS

Download CDS FASTA

969 bp · TkA03G457570|TK1151|CDS

ATGGAGATGGCAGCTCAATTGAAACGGGGGATATCCCGTCAATTCTCCACGGGTTCCATGAAACTCAGCGGTAAATTCAGTTTCAAGCGTCAGAACTCTTTCGATCCACGAACGAATACGCGTTTCAGCTTTGGGCGACAATCGTCGCTTGATCCAATTCGACGTACAAGTACGAAGGATGACTTTACCCTCCCCGGAAACCTTGATTCCACCATGCAATTGCTGTTTCTAGCCTGCAAAAACGACGTTCAGGGCGTCAG...

Protein

Download Protein FASTA

322 aa · TkA03G457570|TK1151|PROTEIN

MEMAAQLKRGISRQFSTGSMKLSGKFSFKRQNSFDPRTNTRFSFGRQSSLDPIRRTSTKDDFTLPGNLDSTMQLLFLACKNDVQGVRELLDDGVDVNSIDLDGRTALHIAACEGHVDVVQLLLSRKANIDARDRWGSTAAADSKYYGHMETYNILKARGAKVPKTRKTPMTVANPREVPEYELNPLELQIRKSDGISKGHYQVAKWNGTKVSVKILDKDSYSDPESINAFKHELTLLEKVRHPNVVQFVGAVTQNIPMMI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G457570`
TK1151 ID	TkA03G457570
OH-1004 ID	LXL04_033403
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 97.826 / OH-1004 67.909 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G457570

Location Chr03:114205401-114208822 (-)

Description Similar to ILK1: Integrin-linked protein kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43850`	Functions as a link between plant defense pathways, stress responses and potassium homeostasis.	No verified direct reference in this release
`At4g18950`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues (By similarity).	No verified direct reference in this release
`At1g14000`	Serine/threonine protein kinase which may function as an adapter protein for BRL2.	No verified direct reference in this release
`At1g73660`	Acts as a negative regulator of salt tolerance.	The genetic locus At1g73660 encodes a putative MAPKKK and negatively regulates salt tolerance in Arabidopsis.2008 · DOI: 10.1007/s11103-008-9306-8 SIS8, a putative mitogen-activated protein kinase kinase kinase, regulates sugar-resistant seedling development in Arabidopsis.2014 · DOI: 10.1111/tpj.12404
`At5g03730`	Acts as a negative regulator in the ethylene response pathway.	CTR1 phosphorylates the central regulator EIN2 to control ethylene hormone signaling from the ER membrane to the nucleus in Arabidopsis.2012 · DOI: 10.1073/pnas.1214848109 Unsaturation of very-long-chain ceramides protects plant from hypoxia-induced damages by modulating ethylene signaling in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005143 CTR1, a negative regulator of the ethylene response pathway in Arabidopsis, encodes a member of the raf family of protein kinases.1993 · DOI: 10.1016/0092-8674(93)90119-b

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033403 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0007229 integrin-mediated signaling pathway Biological Process

GO:0009637 response to blue light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

KEGG gene cross-reference

ath:AT1G14000

ath:AT1G73660

ath:AT2G43850

ath:AT4G18950

ath:AT4G35780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.499

Rank 1 · TkA03G457570 · TK1151

Cell membrane0.405

Rank 2 · TkA03G457570 · TK1151

Nucleus0.261

Rank 3 · TkA03G457570 · TK1151

Golgi apparatus0.053

Rank 4 · TkA03G457570 · TK1151

Mitochondrion0.044

Rank 5 · TkA03G457570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796Ank_272-133 aa

PF24521Ank_KRIT172-124 aa

PF13606Ank_374-97 aa

PF00023Ank75-100 aa

PF13637Ank_480-123 aa

PF13857Ank_589-139 aa

PF00023Ank102-134 aa

PF13606Ank_3102-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G457570	`PF12796`	Ank_2	72	133	8.9e-14	52.5
TkA03G457570	`PF24521`	Ank_KRIT1	72	124	0.0023	18.4
TkA03G457570	`PF13606`	Ank_3	74	97	7.1e-07	29.7
TkA03G457570	`PF00023`	Ank	75	100	3.1e-16	59.3
TkA03G457570	`PF13637`	Ank_4	80	123	1.3e-12	48.3
TkA03G457570	`PF13857`	Ank_5	89	139	1.9e-08	35.2
TkA03G457570	`PF00023`	Ank	102	134	3.1e-16	59.3
TkA03G457570	`PF13606`	Ank_3	102	131	7.1e-07	29.7
TkA03G457570	`PF24521`	Ank_KRIT1	107	163	0.0023	18.4
TkA03G457570	`PF13637`	Ank_4	113	139	1.3e-12	48.3
TkA03G457570	`PF12796`	Ank_2	128	173	8.9e-14	52.5
TkA03G457570	`PF00023`	Ank	140	161	3.1e-16	59.3
TkA03G457570	`PF07714`	PK_Tyr_Ser-Thr	196	313	6.8e-23	82.0
TkA03G457570	`PF13637`	Ank_4	196	206	1.3e-12	48.3
TkA03G457570	`PF00023`	Ank	198	206	3.1e-16	59.3
TkA03G457570	`PF00069`	Pkinase	203	315	8.7e-19	68.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IS56`	Arabidopsis thaliana	sp\|F4IS56\|ILK1_ARATH Integrin-linked protein kinase 1	79.400%	Swiss-Prot	High
`Q93Z30`	Arabidopsis thaliana	sp\|Q93Z30\|BHP_ARATH Serine/threonine-protein kinase 12	43.700%	Swiss-Prot	Medium
`Q9XI87`	Arabidopsis thaliana	sp\|Q9XI87\|VIK_ARATH Serine/threonine-protein kinase VIK	46.000%	Swiss-Prot	Low
`Q9C9U5`	Arabidopsis thaliana	sp\|Q9C9U5\|SIS8_ARATH Probable serine/threonine-protein kinase SIS8	40.700%	Swiss-Prot	Low
`Q05609`	Arabidopsis thaliana	sp\|Q05609\|CTR1_ARATH Serine/threonine-protein kinase CTR1	41.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card