LXL04_033403 | RubberDandelionOmics

Gene overview

LXL04_033403

Reference: OH-1004 Chr: Chr07 Coordinates: 43015937-43018588 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1452 bp · LXL04_033403|LXL04_033403|OH1004|cDNA

ATGGAGATGGCAGCTCAATTGAAACGGGGGATATCCCGTCAATTCTCCACGGGTTCCATGAAACTCAGCGGTAAATTCAGCTTCAAGCGTCAGAACTCTTTCGATCCACGAACGAATACGCGTTTCAGCTTTGGGCGACAATCGTCGCTTGATCCAATTCGACGTACAAGTACGAAGGATGACTTTACCCTCCCCGGAAACCTTGATTCCACCATGCAATTGCTGTTTCTAGCCTGCAAAAACGACGTTCAGGGCGTCAG...

CDS

Download CDS FASTA

1452 bp · LXL04_033403|LXL04_033403|OH1004|CDS

ATGGAGATGGCAGCTCAATTGAAACGGGGGATATCCCGTCAATTCTCCACGGGTTCCATGAAACTCAGCGGTAAATTCAGCTTCAAGCGTCAGAACTCTTTCGATCCACGAACGAATACGCGTTTCAGCTTTGGGCGACAATCGTCGCTTGATCCAATTCGACGTACAAGTACGAAGGATGACTTTACCCTCCCCGGAAACCTTGATTCCACCATGCAATTGCTGTTTCTAGCCTGCAAAAACGACGTTCAGGGCGTCAG...

Protein

Download Protein FASTA

483 aa · LXL04_033403|LXL04_033403|OH1004|PROTEIN

MEMAAQLKRGISRQFSTGSMKLSGKFSFKRQNSFDPRTNTRFSFGRQSSLDPIRRTSTKDDFTLPGNLDSTMQLLFLACKNDVQGVRELLDDGVDVNSIDLDGRTALHIAACEGHVDVVQLLLSRKANIDARDRWGSTAAADSKYYGHMETYNILKARGAKVPKTRKTPMTVANPREVPEYELNPLELQIRKSDGISKARLFFIFYLKGHYQVAKWNGTKVSVKILDKDSYSDPESINAFKHELTLLEKVRHPNVVQFVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033403`
TK1151 ID	TkA03G457570
OH-1004 ID	LXL04_033403
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 97.826 / OH-1004 67.909 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033403

Location Chr07:43015937-43018588 (-)

Description Similar to ILK1: Integrin-linked protein kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43850`	Functions as a link between plant defense pathways, stress responses and potassium homeostasis.	No verified direct reference in this release
`At4g18950`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues (By similarity).	No verified direct reference in this release
`At1g14000`	Serine/threonine protein kinase which may function as an adapter protein for BRL2.	No verified direct reference in this release
`At1g73660`	Acts as a negative regulator of salt tolerance.	The genetic locus At1g73660 encodes a putative MAPKKK and negatively regulates salt tolerance in Arabidopsis.2008 · DOI: 10.1007/s11103-008-9306-8 SIS8, a putative mitogen-activated protein kinase kinase kinase, regulates sugar-resistant seedling development in Arabidopsis.2014 · DOI: 10.1111/tpj.12404
`At4g35780`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033403 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0007229 integrin-mediated signaling pathway Biological Process

GO:0009637 response to blue light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

KEGG gene cross-reference

ath:AT1G14000

ath:AT1G73660

ath:AT2G43850

ath:AT4G18950

ath:AT4G35780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.454

Rank 1 · LXL04_033403 · OH-1004

Cell membrane0.427

Rank 2 · LXL04_033403 · OH-1004

Nucleus0.271

Rank 3 · LXL04_033403 · OH-1004

Golgi apparatus0.046

Rank 4 · LXL04_033403 · OH-1004

Endoplasmic reticulum0.041

Rank 5 · LXL04_033403 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_272-133 aa

PF13637.13Ank_480-123 aa

PF13857.13Ank_589-139 aa

PF00023.37Ank102-134 aa

PF07714.24PK_Tyr_Ser-Thr208-460 aa

PF00069.32Pkinase214-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033403	`PF12796.14`	Ank_2	72	133	2e-13	51.4
LXL04_033403	`PF13637.13`	Ank_4	80	123	7.2e-12	45.9
LXL04_033403	`PF13857.13`	Ank_5	89	139	4.3e-08	34.1
LXL04_033403	`PF00023.37`	Ank	102	134	1.3e-15	57.3
LXL04_033403	`PF07714.24`	PK_Tyr_Ser-Thr	208	460	7.1e-47	160.6
LXL04_033403	`PF00069.32`	Pkinase	214	457	8.2e-40	137.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IS56`	Arabidopsis thaliana	Integrin-linked protein kinase 1	73.415%	Swiss-Prot	strong database homology
`Q93Z30`	Arabidopsis thaliana	Serine/threonine-protein kinase 12	47.846%	Swiss-Prot	moderate database homology
`Q9XI87`	Arabidopsis thaliana	Serine/threonine-protein kinase VIK	38.929%	Swiss-Prot	moderate database homology
`Q9C9U5`	Arabidopsis thaliana	Probable serine/threonine-protein kinase SIS8	36.822%	Swiss-Prot	moderate database homology
`Q8RWL6`	Arabidopsis thaliana	Serine/threonine-protein kinase STY17	35.452%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card