RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G399400
Reference: TK1151 Chr: Chr03 Coordinates: 99277028-99278066 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

987 bp · TkA03G399400|TK1151|cDNA

ATGCTCCCAAAACCCCTCTTCTTCCTCTTCTTCTTCCATCTGGGTTTTGTTCGATTGTTGATTACAGACGCCGACGCCGCTTGTTCCGGTTCTGATCGAGATTCTCTGCTGTTATTCGCCGCTAACTTTCCGACCCTTAACTGGACTGCCGACGTCGATTGCTGTTCATGGGAAGGAATCGATTGTGATGATGCTGGAGATCGGGTTGTGGAGTTGTCGTTACCTGATAGAGGACTTCGTGGTGGTATCCCTTCTTCTCT...

CDS

Download CDS FASTA

987 bp · TkA03G399400|TK1151|CDS

ATGCTCCCAAAACCCCTCTTCTTCCTCTTCTTCTTCCATCTGGGTTTTGTTCGATTGTTGATTACAGACGCCGACGCCGCTTGTTCCGGTTCTGATCGAGATTCTCTGCTGTTATTCGCCGCTAACTTTCCGACCCTTAACTGGACTGCCGACGTCGATTGCTGTTCATGGGAAGGAATCGATTGTGATGATGCTGGAGATCGGGTTGTGGAGTTGTCGTTACCTGATAGAGGACTTCGTGGTGGTATCCCTTCTTCTCT...

Protein

Download Protein FASTA

328 aa · TkA03G399400|TK1151|PROTEIN

MLPKPLFFLFFFHLGFVRLLITDADAACSGSDRDSLLLFAANFPTLNWTADVDCCSWEGIDCDDAGDRVVELSLPDRGLRGGIPSSLQSVTTLSLLNLSSNFLSGPLPDGLFASMNNLHTIDLSYNRLTGRLPDTLPDTLQSLNCSSNHFNGTIQDTFFRSTPNLIAFNISNNSFAGVIPRSICDSSPGLVILDFSLNDFIGIIPTGFGTIPIDIDGARSLQVLSFPGNNLTGEMDESITNLTNLRSLTLFGNSFSGDIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G399400
TK1151 IDTkA03G399400
OH-1004 IDLXL04_009120
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 50.915 / OH-1004 15.966
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G399400
LocationChr03:99277028-99278066 (-)
DescriptionSimilar to PSY1R: Tyrosine-sulfated glycopeptide receptor 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g17240 Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Functional analyses of the CLAVATA2-like proteins and their domains that contribute to CLAVATA2 specificity.2010 · DOI: 10.1104/pp.109.148197
At1g17250 Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance (By similarity).
RESISTANCE TO FUSARIUM OXYSPORUM 1, a dominant Arabidopsis disease-resistance gene, is not race specific.2005 · DOI: 10.1534/genetics.105.042218
Arabidopsis thaliana resistance to fusarium oxysporum 2 implicates tyrosine-sulfated peptide signaling in susceptibility and resistance to root infection.2013 · DOI: 10.1371/journal.pgen.1003525
At2g01820 Involved in auxin signal transduction and cell expansion and proliferation regulation. No verified direct reference in this release
At4g13880 Plays a role in root hair development.
Uncovering genes and ploidy involved in the high diversity in root hair density, length and response to local scarce phosphate in Arabidopsis thaliana.2015 · DOI: 10.1371/journal.pone.0120604
At1g71390 Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009120 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0010073 meristem maintenance Biological Process
GO:0031347 regulation of defense response Biological Process
GO:0045087 innate immune response Biological Process
GO:0045851 pH reduction Biological Process
GO:0051707 response to other organism Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
KEGG gene cross-reference
ath:AT1G17240
ath:AT1G72300
ath:AT2G02220
ath:AT5G53890
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.753
Rank 1 · TkA03G399400 · TK1151
Endoplasmic reticulum0.108
Rank 2 · TkA03G399400 · TK1151
Cytoplasm0.071
Rank 3 · TkA03G399400 · TK1151
Nucleus0.054
Rank 4 · TkA03G399400 · TK1151
Extracellular0.052
Rank 5 · TkA03G399400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_231-63 aa
PF29594LRR_SKP268-171 aa
PF00560LRR_170-89 aa
PF24141LRR_ComC79-158 aa
PF12799LRR_483-102 aa
PF13855LRR_884-128 aa
PF27087LRR_TMOD-LMOD85-121 aa
PF13855LRR_892-150 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G399400PF08263LRRNT_231632.1e-0525.4
TkA03G399400PF29594LRR_SKP2681710.211.6
TkA03G399400PF00560LRR_170892e-1966.2
TkA03G399400PF24141LRR_ComC791583.9e-0524.2
TkA03G399400PF12799LRR_4831026.2e-0936.5
TkA03G399400PF13855LRR_8841282e-1453.8
TkA03G399400PF27087LRR_TMOD-LMOD851210.1412.5
TkA03G399400PF13855LRR_8921502e-1453.8
TkA03G399400PF12799LRR_4921286.2e-0936.5
TkA03G399400PF00560LRR_1931112e-1966.2
TkA03G399400PF08263LRRNT_2941072.1e-0525.4
TkA03G399400PF00560LRR_11171362e-1966.2
TkA03G399400PF12799LRR_41171546.2e-0936.5
TkA03G399400PF23598LRR_141381984.9e-1039.4
TkA03G399400PF27087LRR_TMOD-LMOD1381580.1412.5
TkA03G399400PF13855LRR_81391852e-1453.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SHI3Arabidopsis thalianasp|Q9SHI3|RLP2_ARATH Receptor-like protein 248.600%Swiss-ProtLow
Q9SHI4Arabidopsis thalianasp|Q9SHI4|RLP3_ARATH Receptor-like protein 345.600%Swiss-ProtLow
Q9SIT1Arabidopsis thalianasp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK341.400%Swiss-ProtLow
F4JTU7Arabidopsis thalianasp|F4JTU7|RLP48_ARATH Receptor-like protein 4837.400%Swiss-ProtLow
Q9C9H6Arabidopsis thalianasp|Q9C9H6|RLP11_ARATH Receptor-like protein 1136.400%Swiss-ProtLow

JBrowse

View in Genome Browser